anti-Human erythrocyte Membrane Protein Band 4.9 (Dematin) Antikörper für Immunocytochemistry

Recommended erythrocyte Membrane Protein Band 4.9 (Dematin) Antibody (geliefert von: Anmelden zum Anzeigen )

erythrocyte Membrane Protein Band 4.9 (Dematin) (EPB49) Antikörper
  • MGC80597
  • MGC108072
  • EPB49
  • DMT
  • AI325486
  • Epb4.9
  • Epb49
  • dematin
  • dematin actin binding protein L homeolog
  • dematin actin binding protein
  • dmtn.L
  • DMTN
  • dmtn
  • Dmtn
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4304861
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4304860 ICC IF IHC IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal


Antigen erythrocyte Membrane Protein Band 4.9 (Dematin) (EPB49) Antikörper
Reaktivität Human
(60), (41), (14), (3), (1), (1), (1)
Wirt Kaninchen
(58), (2)
Konjugat Unkonjugiert
(3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(33), (23), (16), (12), (11), (11), (1), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVVTNKGRTKLPP
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Andere Bezeichnung Dematin (EPB49 Antibody Abstract)
Hintergrund Gene Symbol: EPB49
Gen-ID 2039
Forschungsgebiet Signaling, Microfilaments, Cytoskeleton
Pathways Regulation of Actin Filament Polymerization


Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013


Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-erythrocyte Membrane Protein Band 4.9 (Dematin) (EPB49) antibody (ABIN4304861) Immunocytochemistry/Immunofluorescence: Dematin Antibody [NBP1-85007] Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-erythrocyte Membrane Protein Band 4.9 (Dematin) (EPB49) antibody (ABIN4304861) Immunohistochemistry-Paraffin: Dematin Antibody [NBP1-85007] - Immunohistochemical st...