anti-Human Carboxypeptidase B2 (Plasma) Antikörper für Immunocytochemistry

Recommended Carboxypeptidase B2 (Plasma) Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Carboxypeptidase B2 (Plasma) (CPB2) Antikörper
  • 1700120C01Rik
  • AI325129
  • CPB1
  • CPB2
  • CPbeat2
  • CPbeta1
  • CPbeta2
  • Cappb1
  • CPU
  • PCPB
  • TAFI
  • 1110032P04Rik
  • 4930405E17Rik
  • AI255929
  • CPR
  • Cpu
  • pCPB
  • capping protein (actin filament) muscle Z-line, beta
  • carboxypeptidase B2 (plasma)
  • Capzb
  • CPB2
  • Cpb2
Reaktivität
Human
155
43
26
2
1
1
1
1
1
Wirt
Kaninchen
83
83
16
Klonalität
Polyklonal
Konjugat
Unkonjugiert
10
9
8
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
120
119
16
13
8
7
5
5
5
3
3
2
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4287866
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1860678 ICC IHC IP WB Rabbit IgG AA 138-423 Anmelden zum Anzeigen Polyclonal

General

Antigen Carboxypeptidase B2 (Plasma) (CPB2) Antikörper
Reaktivität Human
(155), (43), (26), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(83), (83), (16)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(10), (9), (8), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(120), (119), (16), (13), (8), (7), (5), (5), (5), (3), (3), (2), (2), (2), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYSWIEFITERHPDMLTKIHIGSSFEKYPLYVLKVSGKEQAA
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung Carboxypeptidase B2/CPB2 (CPB2 Antibody Abstract)
Hintergrund Gene Symbol: CPB2
Gen-ID 1361
Pathways Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Carboxypeptidase B2 (Plasma) (CPB2) antibody (ABIN4287866) Immunohistochemistry-Paraffin: Carboxypeptidase B2 Antibody [NBP1-85469] - Staining o...
Immunofluorescence (IF) image for anti-Carboxypeptidase B2 (Plasma) (CPB2) antibody (ABIN4287866) Immunocytochemistry/Immunofluorescence: Carboxypeptidase B2 Antibody [NBP1-85469] - I...