anti-Human CAPZA2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended CAPZA2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Capping Protein (Actin Filament) Muscle Z-Line, alpha 2 (CAPZA2) Antikörper
  • CAPZA2
  • CAPPA2
  • CAPZ
  • 1110053K06Rik
  • AW208808
  • Cappa2
  • CapZ
  • capping protein (actin filament) muscle Z-line, alpha 2
  • F-actin-capping protein subunit alpha-2
  • CAPZA2
  • caza2
  • Capza2
Reaktivität
Human, Maus, Ratte (Rattus)
43
32
31
2
2
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
34
9
Klonalität
Polyklonal
Konjugat
Dieser CAPZA2 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
30
13
13
11
6
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4287691
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN710105 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN710098 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN710096 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Capping Protein (Actin Filament) Muscle Z-Line, alpha 2 (CAPZA2) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(43), (32), (31), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(34), (9)
Klonalität
Polyklonal
Konjugat Dieser CAPZA2 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(30), (13), (13), (11), (6), (3), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CAPZA2 Antikörper

Target Details CAPZA2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQA
Isotyp IgG

Target Details CAPZA2

Produktdetails anti-CAPZA2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CAPZA2 (CAPZA2 Antibody Abstract)
Hintergrund Gene Symbol: CAPZA2
Gen-ID 830
Forschungsgebiet Signaling, Microfilaments, Cytoskeleton
Pathways Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails anti-CAPZA2 Antikörper Target Details CAPZA2 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CAPZA2 Antikörper Target Details CAPZA2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-CAPZA2 Antikörper Target Details CAPZA2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Capping Protein (Actin Filament) Muscle Z-Line, alpha 2 (CAPZA2) antibody (ABIN4287691) Western Blot: CAPZA2 Antibody [NBP1-86632] - Lane 1: Marker [kDa] 230, 130, 95, 72, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Capping Protein (Actin Filament) Muscle Z-Line, alpha 2 (CAPZA2) antibody (ABIN4287691) Immunohistochemistry-Paraffin: CAPZA2 Antibody [NBP1-86632] - Staining of human lymph...
Immunofluorescence (IF) image for anti-Capping Protein (Actin Filament) Muscle Z-Line, alpha 2 (CAPZA2) antibody (ABIN4287691) Immunocytochemistry/Immunofluorescence: CAPZA2 Antibody [NBP1-86632] - Staining of hu...
Western Blotting (WB) image for anti-Capping Protein (Actin Filament) Muscle Z-Line, alpha 2 (CAPZA2) antibody (ABIN4287691) Western Blot: CAPZA2 Antibody [NBP1-86632] - Lane 1: NIH-3T3 cell lysate (Mouse embry...