anti-Ratte (Rattus) BAI1-Associated Protein 2-Like-1 Antikörper für Immunocytochemistry

Recommended BAI1-Associated Protein 2-Like-1 Antibody (geliefert von: Anmelden zum Anzeigen )

BAI1-Associated Protein 2-Like-1 (BAIAP2L1) Antikörper
  • cb1023
  • baiap2l1
  • zgc:85624
  • BAIAP2L1
  • MGC131079
  • 1300006M19Rik
  • AI585895
  • RGD1308452
  • BAI1-associated protein 2-like 1a
  • BAI1-associated protein 2-like 1
  • baiap2l1a
  • BAIAP2L1
  • baiap2l1
  • LOC100224219
  • Baiap2l1
Human, Maus, Ratte (Rattus)
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4282989
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4282990 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal


Antigen BAI1-Associated Protein 2-Like-1 (BAIAP2L1) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(39), (16), (15)
Wirt Kaninchen
(28), (11)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(37), (17), (12), (11), (7), (6), (1), (1), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLSEN
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung BAIAP2L1 (BAIAP2L1 Antibody Abstract)
Hintergrund Gene Symbol: BAIAP2L1
Gen-ID 55971
Forschungsgebiet Signaling, Microfilaments, Cytoskeleton
Pathways Regulation of Actin Filament Polymerization


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-BAI1-Associated Protein 2-Like-1 (BAIAP2L1) antibody (ABIN4282989) Immunocytochemistry/Immunofluorescence: BAIAP2L1 Antibody [NBP1-89537] - Staining of ...
Western Blotting (WB) image for anti-BAI1-Associated Protein 2-Like-1 (BAIAP2L1) antibody (ABIN4282989) Western Blot: BAIAP2L1 Antibody [NBP1-89537] - Lane 1: NIH-3T3 cell lysate (Mouse emb...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-BAI1-Associated Protein 2-Like-1 (BAIAP2L1) antibody (ABIN4282989) Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537] - Staining of human rec...
Western Blotting (WB) image for anti-BAI1-Associated Protein 2-Like-1 (BAIAP2L1) antibody (ABIN4282989) Western Blot: BAIAP2L1 Antibody [NBP1-89537] - Lane 1: Marker [kDa] 230, 130, 95, 72,...
Immunofluorescence (IF) image for anti-BAI1-Associated Protein 2-Like-1 (BAIAP2L1) antibody (ABIN4282989) Immunocytochemistry/Immunofluorescence: BAIAP2L1 Antibody - Staining of human cell l...