anti-Human Advillin Antikörper für Immunohistochemistry

Recommended Advillin Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Advillin (AVIL) Antikörper
  • Adv
  • SpAdv
  • villin
  • zgc:136857
  • ADVIL
  • DOC6
  • p92
  • Advil
  • advillin
  • AVIL
  • Adv
  • avil
  • CpipJ_CPIJ004696
  • Avil
Reaktivität
Human
51
27
27
9
7
6
6
6
2
2
1
1
Wirt
Kaninchen
55
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
41
19
15
13
13
6
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4278537
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1966078 FACS IHC ELISA WB Biotin Rabbit IgG AA 176-204 Anmelden zum Anzeigen Polyclonal
1 ABIN1963410 FACS IHC ELISA WB APC Rabbit IgG AA 176-204 Anmelden zum Anzeigen Polyclonal
1 ABIN1961035 FACS IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 176-204 Anmelden zum Anzeigen Polyclonal
1 ABIN1969858 FACS IHC ELISA WB FITC Rabbit IgG AA 176-204 Anmelden zum Anzeigen Polyclonal
1 ABIN1972116 FACS IHC ELISA WB HRP Rabbit IgG AA 176-204 Anmelden zum Anzeigen Polyclonal
1 ABIN1974447 FACS IHC ELISA WB PE Rabbit IgG AA 176-204 Anmelden zum Anzeigen Polyclonal
1 ABIN2207233 IHC ELISA WB HRP Rabbit IgG N-Term, AA 183-212 Anmelden zum Anzeigen Polyclonal
1 ABIN2207239 FACS IHC ELISA WB FITC Rabbit IgG N-Term, AA 183-212 Anmelden zum Anzeigen Polyclonal
1 ABIN2207234 FACS IHC ELISA WB PE Rabbit IgG N-Term, AA 183-212 Anmelden zum Anzeigen Polyclonal
1 ABIN2207237 FACS IHC ELISA WB APC Rabbit IgG N-Term, AA 183-212 Anmelden zum Anzeigen Polyclonal
1 ABIN2207240 FACS IHC ELISA WB Rabbit IgG N-Term, AA 183-212 Anmelden zum Anzeigen Polyclonal
1 ABIN2207236 FACS IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG N-Term, AA 183-212 Anmelden zum Anzeigen Polyclonal
1 ABIN2207238 FACS IHC ELISA WB Biotin Rabbit IgG N-Term, AA 183-212 Anmelden zum Anzeigen Polyclonal

General

Antigen Advillin (AVIL) Antikörper
Reaktivität Human
(51), (27), (27), (9), (7), (6), (6), (6), (2), (2), (1), (1)
Wirt Kaninchen
(55)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(41), (19), (15), (13), (13), (6)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: HASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPA
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Advillin (AVIL Antibody Abstract)
Hintergrund Gene Symbol: AVIL
Gen-ID 10677
UniProt O75366
Forschungsgebiet Organogenesis
Pathways Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Advillin (AVIL) antibody (ABIN4278537) Immunohistochemistry: Advillin Antibody [NBP2-34118] - duodenum
Western Blotting (WB) image for anti-Advillin (AVIL) antibody (ABIN4278537) Western Blot: Advillin Antibody [NBP2-34118] - Lane 1: Marker [kDa] 250, 130, 95, 72,...
Immunohistochemistry (IHC) image for anti-Advillin (AVIL) antibody (ABIN4278537) Immunohistochemistry: Advillin Antibody [NBP2-34118] - liver cancer
Immunohistochemistry (IHC) image for anti-Advillin (AVIL) antibody (ABIN4278537) Immunohistochemistry: Advillin Antibody [NBP2-34118] - Immunohistochemical staining o...