Adiponectin, C1Q and Collagen Domain Containing (ADIPOQ) protein (HIS)

Name: Adiponectin, C1Q and Collagen Domain Containing (ADIPOQ)

Synonyme: ACDC, ADPN, APM1, APM-1, GBP28, ACRP30, ADIPQTL1, adiponectin, APN, Acdc, apM1, 30kDa, adipo, Acrp30, ADIPOQ, MGC138982, ADN, MGC84292

Protein-Typ: Recombinant

Herkunft (Gen): Human

Konjugat: HIS

Applikation: ELISA, Western Blot (WB)

Zertifikate: ISO 9001:2008

Produktnummer: ABIN618892

Produktbeschreibung

Gen-ID: NM_001177800.1

Sequenz: ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGR DGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQ GRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYN QQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKK DKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGE GERNGLYADNDNDSTFTGFLLYHDTN

Beschreibung: Background: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.

Molekulargewicht: 30 KD

Anwendungen

Reinheit: 90%

Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0, 200 mM Imidazole

Lagerung: Store at -20 C, for extended storage, conserve at -20 C or -80 C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 C for up to one week.

Forschungsgebiet: Krebs, Artherosklerose, Metabolismus, Hormone

Beschränkungen: Nur für Forschungszwecke einsetzbar