Peroxiredoxin 1 (PRDX1) protein (GST)

Name: Peroxiredoxin 1 (PRDX1)

Synonyme: PAG, PAGA, PAGB, PRX1, PRXI, MSP23, NKEFA, TDPX2, OSF3, Paga, PrxI, TDX2, TPxA, prx1, NkefA, OSF-3, PrdxI, Tdpx2, Hbp23, MGC108617, MGC80194, MGC84820, PRDX1, pag, paga, pagb, msp23, nkefa, tdpx2, cb58, prdx1, MGC92891, zgc:92891, wu:fq19b09, DPx4156, Jafrac-2, Prx4156, DmelCG1274, CG1274

Protein-Typ: Recombinant

Herkunft (Gen): Human

Konjugat: GST

Applikation: SDS-PAGE (SDS), ELISA, Western Blot (WB)

Zertifikate: ISO 9001:2008

Produktnummer: ABIN618741

Produktbeschreibung

Gen-ID: NM_002574

Sequenz: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVV FFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDS HFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLV QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK-

Beschreibung: Background: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. Synonyms: Natural killer cell-enhancing factor A Short name=NKEF-A Proliferation-associated gene protein Short name=PAG Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2.

Molekulargewicht: 22 KD

Synonyme: PAG, PAGA, PAGB, PRX1, PRXI, MSP23, NKEFA, TDPX2, OSF3, Paga, PrxI, TDX2, TPxA, prx1, NkefA, OSF-3, PrdxI, Tdpx2, Hbp23, MGC108617, MGC80194, MGC84820, PRDX1, pag, paga, pagb, msp23, nkefa, tdpx2, cb58, prdx1, MGC92891, zgc:92891, wu:fq19b09, DPx4156, Jafrac-2, Prx4156, DmelCG1274, CG1274

Anwendungen

Reinheit: 95%

Buffer: 6M guanidine hydrochloride, 20mM Tris

Lagerung: Store at -20 C, for extended storage, conserve at -20 C or -80 C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 C for up to one week.

Beschränkungen: Nur für Forschungszwecke einsetzbar