anti-Human PPP2R5E Antikörper für Immunohistochemistry

Recommended PPP2R5E Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Protein Phosphatase 2, Regulatory Subunit B', epsilon Isoform (PPP2R5E) Antikörper
  • wdb2
  • ppp2r5e
  • ppp2r5e1
  • PPP2R5E
  • 4633401M22Rik
  • AI449017
  • B56beta
  • protein phosphatase 2, regulatory subunit B', epsilon isoform b
  • protein phosphatase 2, regulatory subunit B', epsilon isoform
  • protein phosphatase 2, regulatory subunit B', beta
  • protein phosphatase 2, regulatory subunit B', alpha
  • protein phosphatase 2, regulatory subunit B (B56), epsilon isoform
  • ppp2r5eb
  • ppp2r5e
  • PPP2R5E
  • ppp2r5b
  • ppp2r5a
  • Ppp2r5e
Reaktivität
Human
23
20
9
7
7
4
4
4
4
3
3
3
2
2
2
1
Wirt
Kaninchen
16
16
1
Klonalität
Polyklonal
Konjugat
Dieser PPP2R5E Antikörper ist unkonjugiert
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
30
15
4
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4347126
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2576679 ELISA IHC WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN2687008 IHC ELISA WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN1856692 IHC ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN3060794 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal

anti-PPP2R5E Antikörper für Immunohistochemistry mit den meisten Publikationen

Ähnliche anti-PPP2R5E Antikörper

Applikation / Reaktivität Human
ELISA 5 Antikörper
Immunocytochemistry (ICC) 1 Antikörper
Immunofluorescence (IF) 1 Antikörper
Immunohistochemistry (IHC) 5 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antikörper
Western Blotting (WB) 18 Antikörper

General

Antigen Protein Phosphatase 2, Regulatory Subunit B', epsilon Isoform (PPP2R5E) Antikörper
Reaktivität Human
(23), (20), (9), (7), (7), (4), (4), (4), (4), (3), (3), (3), (2), (2), (2), (1)
Wirt Kaninchen
(16), (16), (1)
Klonalität
Polyklonal
Konjugat Dieser PPP2R5E Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(30), (15), (4)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PPP2R5E Antikörper

Target Details PPP2R5E Anwendungsinformationen Handhabung ProductDetails: References for anti-PPP2R5E antibody (ABIN4347126) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPH
Isotyp IgG

Target Details PPP2R5E

Produktdetails anti-PPP2R5E Antikörper Anwendungsinformationen Handhabung ProductDetails: References for anti-PPP2R5E antibody (ABIN4347126) Bilder zurück nach oben
Antigen
Andere Bezeichnung PPP2R5E (PPP2R5E Antibody Abstract)
Hintergrund Gene Symbol: PPP2R5E
Gen-ID 5529
Forschungsgebiet Signaling
Pathways PI3K-Akt Signalweg

Anwendungsinformationen

Produktdetails anti-PPP2R5E Antikörper Target Details PPP2R5E Handhabung ProductDetails: References for anti-PPP2R5E antibody (ABIN4347126) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PPP2R5E Antikörper Target Details PPP2R5E Anwendungsinformationen ProductDetails: References for anti-PPP2R5E antibody (ABIN4347126) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-PPP2R5E antibody (ABIN4347126)

Produktdetails anti-PPP2R5E Antikörper Target Details PPP2R5E Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

DeGrande, Little, Nixon, Wright, Snyder, Dun, Murphy, Kilic, Higgins, Binkley, Boyden, Carnes, Anderson, Hund, Mohler: "Molecular mechanisms underlying cardiac protein phosphatase 2A regulation in heart." in: The Journal of biological chemistry, Vol. 288, Issue 2, pp. 1032-46, 2013

Bilder

Produktdetails anti-PPP2R5E Antikörper Target Details PPP2R5E Anwendungsinformationen Handhabung ProductDetails: References for anti-PPP2R5E antibody (ABIN4347126) zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-PPP2R5E Antikörper (Protein Phosphatase 2, Regulatory Subunit B', epsilon Isoform) (ABIN4347126) Immunocytochemistry/Immunofluorescence: PPP2R5E Antibody [NBP1-89464] Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PPP2R5E Antikörper (Protein Phosphatase 2, Regulatory Subunit B', epsilon Isoform) (ABIN4347126) Immunohistochemistry-Paraffin: PPP2R5E Antibody [NBP1-89464] - Staining of human stom...