anti-Human LAMTOR2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended LAMTOR2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) Antikörper
  • ENDAP
  • HSPC003
  • MAPBPIP
  • MAPKSP1AP
  • ROBLD3
  • Ragulator2
  • p14
  • 2010111E04Rik
  • AL022628
  • Mapbpip
  • P14
  • Rab25
  • Robld3
  • robld3
  • zgc:100811
  • mapbpip
  • RGD1562501
  • late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
  • LAMTOR2
  • Lamtor2
  • lamtor2
Reaktivität
Human
37
19
17
Wirt
Kaninchen
37
Klonalität
Polyklonal
Konjugat
Dieser LAMTOR2 Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
22
17
16
13
8
4
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4350844
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN657261 IHC (p) WB Rabbit Ig AA 41-70, Center Anmelden zum Anzeigen Polyclonal
1 ABIN4350843 ICC IF IHC IHC (p) Rabbit AA 1-125, N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1712086 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1701069 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1714571 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1810344 IHC (p) WB Rabbit AA 41-70 Anmelden zum Anzeigen Polyclonal
1 ABIN5587092 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN3200988 ICC IF IHC (p) Rabbit AA 1-125, N-Term Anmelden zum Anzeigen Polyclonal

Ähnliche anti-LAMTOR2 Antikörper

Applikation / Reaktivität Human
ELISA 16 Antikörper
Immunocytochemistry (ICC) 3 Antikörper
Immunofluorescence (IF) 5 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 18 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antikörper
Western Blotting (WB) 23 Antikörper

General

Antigen Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) Antikörper
Reaktivität Human
(37), (19), (17)
Wirt Kaninchen
(37)
Klonalität
Polyklonal
Konjugat Dieser LAMTOR2 Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(22), (17), (16), (13), (8), (4), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-LAMTOR2 Antikörper

Target Details LAMTOR2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP
Isotyp IgG

Target Details LAMTOR2

Produktdetails anti-LAMTOR2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung ROBLD3 (LAMTOR2 Antibody Abstract)
Hintergrund Gene Symbol: LAMTOR2
Gen-ID 28956
Pathways PI3K-Akt Signalweg

Anwendungsinformationen

Produktdetails anti-LAMTOR2 Antikörper Target Details LAMTOR2 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-LAMTOR2 Antikörper Target Details LAMTOR2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-LAMTOR2 Antikörper Target Details LAMTOR2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-LAMTOR2 Antikörper (Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2) (ABIN4350844) Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody [NBP1-87951] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-LAMTOR2 Antikörper (Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2) (ABIN4350844) Immunohistochemistry-Paraffin: ROBLD3 Antibody [NBP1-87951] - Staining of human stoma...
Western Blotting (WB) image for anti-LAMTOR2 Antikörper (Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2) (ABIN4350844) Western Blot: ROBLD3 Antibody [NBP1-87951] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-LAMTOR2 Antikörper (Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2) (ABIN4350844) Immunohistochemistry-Paraffin: ROBLD3 Antibody [NBP1-87951] - Staining of human colon...