anti-Human CDK2AP2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended CDK2AP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Cyclin-Dependent Kinase 2 Associated Protein 2 (CDK2AP2) Antikörper
  • zgc:92182
  • 5830466O21Rik
  • D19Ertd144e
  • Doc-1r
  • p33(CDK2)
  • DOC-1R
  • p14
  • cyclin-dependent kinase 2 associated protein 2
  • CDK2-associated protein 2
  • cyclin-dependent kinase 2
  • cdk2ap2
  • Cdk2ap2
  • CDK2
  • CDK2AP2
Reaktivität
Human
44
19
17
Wirt
Kaninchen
40
4
Klonalität
Polyklonal
Konjugat
Dieser CDK2AP2 Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
26
20
13
4
3
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4297050
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2889352 IHC (p) ELISA Rabbit IgG AA 51-100 Anmelden zum Anzeigen Polyclonal
1 ABIN889763 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN889767 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN872407 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Cyclin-Dependent Kinase 2 Associated Protein 2 (CDK2AP2) Antikörper
Reaktivität Human
(44), (19), (17)
Wirt Kaninchen
(40), (4)
Klonalität
Polyklonal
Konjugat Dieser CDK2AP2 Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(26), (20), (13), (4), (3)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CDK2AP2 Antikörper

Target Details CDK2AP2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMG
Isotyp IgG

Target Details CDK2AP2

Produktdetails anti-CDK2AP2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CDK2AP2 (CDK2AP2 Antibody Abstract)
Hintergrund Gene Symbol: CDK2AP2
Gen-ID 10263
Pathways PI3K-Akt Signalweg, Zellzyklus, Mitotic G1-G1/S Phases, DNA Replication, M Phase, Synthesis of DNA

Anwendungsinformationen

Produktdetails anti-CDK2AP2 Antikörper Target Details CDK2AP2 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CDK2AP2 Antikörper Target Details CDK2AP2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-CDK2AP2 Antikörper Target Details CDK2AP2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Cyclin-Dependent Kinase 2 Associated Protein 2 (CDK2AP2) antibody (ABIN4297050) Western Blot: CDK2AP2 Antibody [NBP1-91776] - Lane 1: Marker [kDa] 250, 130, 95, 72, ...
Immunofluorescence (IF) image for anti-Cyclin-Dependent Kinase 2 Associated Protein 2 (CDK2AP2) antibody (ABIN4297050) Immunocytochemistry/Immunofluorescence: CDK2AP2 Antibody [NBP1-91776] - Staining of h...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cyclin-Dependent Kinase 2 Associated Protein 2 (CDK2AP2) antibody (ABIN4297050) Immunohistochemistry-Paraffin: CDK2AP2 Antibody [NBP1-91776] - Staining of human colo...