anti-Human CRLF3 Antikörper für Immunofluorescence

Recommended CRLF3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Cytokine Receptor-Like Factor 3 (CRLF3) Antikörper
  • CREME-9
  • CREME9
  • CRLM9
  • CYTOR4
  • FRWS
  • p48.2
  • BB164954
  • Creme9
  • Cytor4
  • fd20c08
  • id:ibd2508
  • im:7137736
  • wu:fd20c08
  • zgc:110212
  • cytokine receptor-like factor 3
  • CRLF3
  • Crlf3
  • crlf3
Reaktivität
Human
30
3
1
Wirt
Kaninchen
26
4
Klonalität
Polyklonal
Konjugat
Dieser CRLF3 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
28
15
4
3
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4300536
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.14905 ABIN526687 IF WB Mouse AA 1-442, full length Anmelden zum Anzeigen Polyclonal
12.14905 ABIN526688 IF WB Mouse AA 1-442, full length Anmelden zum Anzeigen Polyclonal
1 ABIN2596641 IF WB Mouse IgG AA 1-442 Anmelden zum Anzeigen Polyclonal
1 ABIN2241600 IF WB Mouse IgG AA 1-442 Anmelden zum Anzeigen Polyclonal

General

Antigen Cytokine Receptor-Like Factor 3 (CRLF3) Antikörper
Reaktivität Human
(30), (3), (1)
Wirt Kaninchen
(26), (4)
Klonalität
Polyklonal
Konjugat Dieser CRLF3 Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(28), (15), (4), (3)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CRLF3 Antikörper

Target Details CRLF3 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IEHGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTSNHFEDVYVGSE
Isotyp IgG

Target Details CRLF3

Produktdetails anti-CRLF3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CRLF3 (CRLF3 Antibody Abstract)
Hintergrund Gene Symbol: CRLF3
Gen-ID 51379
Forschungsgebiet Immunology, Cytokines, Innate Immunity
Pathways p53 Signalweg

Anwendungsinformationen

Produktdetails anti-CRLF3 Antikörper Target Details CRLF3 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CRLF3 Antikörper Target Details CRLF3 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-CRLF3 Antikörper Target Details CRLF3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cytokine Receptor-Like Factor 3 (CRLF3) antibody (ABIN4300536) Immunohistochemistry-Paraffin: CRLF3 Antibody [NBP1-84382] - Immunohistochemical stai...
Immunofluorescence (IF) image for anti-Cytokine Receptor-Like Factor 3 (CRLF3) antibody (ABIN4300536) Immunocytochemistry/Immunofluorescence: CRLF3 Antibody [NBP1-84382] - Staining of hum...
Western Blotting (WB) image for anti-Cytokine Receptor-Like Factor 3 (CRLF3) antibody (ABIN4300536) Western Blot: CRLF3 Antibody [NBP1-84382] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...