anti-Human rho Guanine Nucleotide Exchange Factor (GEF) 4 Antikörper für Immunohistochemistry

Recommended rho Guanine Nucleotide Exchange Factor (GEF) 4 Antibody (geliefert von: Anmelden zum Anzeigen )

rho Guanine Nucleotide Exchange Factor (GEF) 4 (ARHGEF4) Antikörper
  • ASEF
  • ASEF1
  • GEF4
  • STM6
  • 9330140K16Rik
  • Asef
  • ENSMUSG00000070955
  • Rho guanine nucleotide exchange factor (GEF) 4
  • Rho guanine nucleotide exchange factor 4
  • arhg4
  • Arhgef4
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4281554
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2408080 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

Ähnliche anti-rho Guanine Nucleotide Exchange Factor (GEF) 4 Antikörper

Applikation / Reaktivität Human
ELISA 29 Antikörper
Flow Cytometry (FACS) 9 Antikörper
Immunohistochemistry (IHC) 2 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antikörper
Western Blotting (WB) 43 Antikörper


Antigen rho Guanine Nucleotide Exchange Factor (GEF) 4 (ARHGEF4) Antikörper
Reaktivität Human
(46), (2), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(20), (16), (10)
Konjugat Unkonjugiert
(7), (3), (3), (3), (3), (3)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(43), (29), (9), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETG
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung ARHGEF4 (ARHGEF4 Antibody Abstract)
Hintergrund Gene Symbol: ARHGEF4
Gen-ID 50649
Forschungsgebiet Signaling, Receptors, Proteolysis / Ubiquitin, Immunology, Cytokines, Growth Factors, Inflammation
Pathways Neurotrophin Signalübertragung


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-rho Guanine Nucleotide Exchange Factor (GEF) 4 (ARHGEF4) Antikörper (ABIN4281554) Immunohistochemistry: ARHGEF4 Antibody [NBP1-88857] - Staining of human bone marrow s...