anti-Human Vinexin Antikörper für Immunocytochemistry

Recommended Vinexin Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Sorbin and SH3 Domain Containing 3 (Sorbs3) Antikörper
  • zgc:113031
  • si:dkey-162f21.1
  • SCAM-1
  • SH3P3
  • Sh3d4
  • vinexin-g
  • SCAM1
  • SH3D4
  • sorbin and SH3 domain containing 3
  • SORBS3
  • sorbs3
  • Sorbs3
Reaktivität
Human
22
19
17
Wirt
Kaninchen
23
3
Klonalität
Polyklonal
Konjugat
Dieser Vinexin Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
14
13
7
6
4
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5080491
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4365529 ICC IF IHC IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal

Ähnliche anti-Vinexin Antikörper

Applikation / Reaktivität Human
Immunocytochemistry (ICC) 2 Antikörper
Immunofluorescence (IF) 5 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 3 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 7 Antikörper
Western Blotting (WB) 10 Antikörper

General

Antigen Sorbin and SH3 Domain Containing 3 (Sorbs3) Antikörper
Reaktivität Human
(22), (19), (17)
Wirt Kaninchen
(23), (3)
Klonalität
Polyklonal
Konjugat Dieser Vinexin Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(14), (13), (7), (6), (4), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Vinexin Antikörper

Target Details Vinexin Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YRRMFQQIHRKMPDLQLDWTFEEPPRDPRHLGAQQRPAHRPGPATSSSGRSWDHSEELPRSTFNYRPGAFSTVLQPSNQVLRRREKVDNVWTEESWNQFLQELETGQRPKKPLVDDPGEKPSQPIE
Isotyp IgG

Target Details Vinexin

Produktdetails anti-Vinexin Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Vinexin (Sorbs3 Antibody Abstract)
Hintergrund Gene Symbol: SORBS3
Gen-ID 10174
Forschungsgebiet Signaling, Extracellular Matrix, Microfilaments, Cytoskeleton
Pathways MAPK Signalweg

Anwendungsinformationen

Produktdetails anti-Vinexin Antikörper Target Details Vinexin Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-Vinexin Antikörper Target Details Vinexin Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-Vinexin Antikörper Target Details Vinexin Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Vinexin Antikörper (Sorbin and SH3 Domain Containing 3) (ABIN5080491) Immunocytochemistry/Immunofluorescence: Vinexin Antibody - Staining of human cell li...