anti-Human SPAG5 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended SPAG5 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Sperm Associated Antigen 5 (SPAG5) Antikörper
  • SPAG5
  • DEEPEST
  • MAP126
  • hMAP126
  • AI874642
  • D11Bhm180e
  • Deepest
  • Mastrin
  • S17
  • sperm associated antigen 5
  • sperm-associated antigen 5
  • SPAG5
  • LOC739263
  • Spag5
Reaktivität
Human
33
7
4
1
1
1
1
Wirt
Kaninchen
30
4
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
29
11
8
6
6
2
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4281930
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.794758 ABIN4281929 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN672261 IF (p) IHC (p) WB Rabbit IgG AA 1120-1170 Anmelden zum Anzeigen Polyclonal

General

Antigen Sperm Associated Antigen 5 (SPAG5) Antikörper
Reaktivität Human
(33), (7), (4), (1), (1), (1), (1)
Wirt Kaninchen
(30), (4)
Klonalität
Polyklonal
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(29), (11), (8), (6), (6), (2), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SPAG5 Antikörper

Target Details SPAG5 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DTVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSL
Isotyp IgG

Target Details SPAG5

Produktdetails anti-SPAG5 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Astrin (SPAG5 Antibody Abstract)
Hintergrund Gene Symbol: SPAG5
Gen-ID 10615
UniProt Q96R06
Pathways M Phase

Anwendungsinformationen

Produktdetails anti-SPAG5 Antikörper Target Details SPAG5 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SPAG5 Antikörper Target Details SPAG5 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SPAG5 Antikörper Target Details SPAG5 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Sperm Associated Antigen 5 (SPAG5) antibody (ABIN4281930) Immunohistochemistry-Paraffin: Astrin Antibody [NBP1-85262] - Staining of human small...
Western Blotting (WB) image for anti-Sperm Associated Antigen 5 (SPAG5) antibody (ABIN4281930) Western Blot: Astrin Antibody [NBP1-85262] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunofluorescence (IF) image for anti-Sperm Associated Antigen 5 (SPAG5) antibody (ABIN4281930) Immunocytochemistry/Immunofluorescence: Astrin Antibody [NBP1-85262] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Sperm Associated Antigen 5 (SPAG5) antibody (ABIN4281930) Immunohistochemistry-Paraffin: Astrin Antibody [NBP1-85262] - Staining of human testi...