anti-Human MASP2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended MASP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Mannan-Binding Lectin serine Peptidase 2 (MASP2) Antikörper
  • MAP19
  • MASP-2
  • MASP1P1
  • sMAP
  • MAp19
  • mannan-binding lectin serine peptidase 2
  • MASP2
  • Masp2
Reaktivität
Human
57
24
17
3
2
2
2
1
1
1
1
Wirt
Kaninchen
54
4
Klonalität
Polyklonal
Konjugat
Dieser MASP2 Antikörper ist unkonjugiert
6
5
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
45
24
13
7
7
6
4
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4332777
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.400779 ABIN4332776 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN676223 IF (p) IHC (p) WB Rabbit IgG AA 400-445 Anmelden zum Anzeigen Polyclonal
1 ABIN676232 IHC (p) WB HRP Rabbit IgG AA 400-445 Anmelden zum Anzeigen Polyclonal
1 ABIN676225 IHC (p) WB Biotin Rabbit IgG AA 400-445 Anmelden zum Anzeigen Polyclonal
1 ABIN1859762 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG AA 170-287 Anmelden zum Anzeigen
1 ABIN1865092 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG Anmelden zum Anzeigen

Ähnliche anti-MASP2 Antikörper

Applikation / Reaktivität Human
ELISA 24 Antikörper
Immunocytochemistry (ICC) 7 Antikörper
Immunofluorescence (IF) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 8 Antikörper
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 7 Antikörper
Immunoprecipitation (IP) 4 Antikörper
Western Blotting (WB) 45 Antikörper

General

Antigen Mannan-Binding Lectin serine Peptidase 2 (MASP2) Antikörper
Reaktivität Human
(57), (24), (17), (3), (2), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(54), (4)
Klonalität
Polyklonal
Konjugat Dieser MASP2 Antikörper ist unkonjugiert
(6), (5), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(45), (24), (13), (7), (7), (6), (4), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-MASP2 Antikörper

Target Details MASP2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGL
Isotyp IgG

Target Details MASP2

Produktdetails anti-MASP2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung MASP2 (MASP2 Antibody Abstract)
Hintergrund Gene Symbol: MASP2
Gen-ID 10747
Forschungsgebiet Immunology, Innate Immunity
Pathways Komplementsystem

Anwendungsinformationen

Produktdetails anti-MASP2 Antikörper Target Details MASP2 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-MASP2 Antikörper Target Details MASP2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-MASP2 Antikörper Target Details MASP2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MASP2 Antikörper (Mannan-Binding Lectin serine Peptidase 2) (ABIN4332777) Immunohistochemistry-Paraffin: MASP2 Antibody [NBP1-81259] - Staining of human duoden...
Western Blotting (WB) image for anti-MASP2 Antikörper (Mannan-Binding Lectin serine Peptidase 2) (ABIN4332777) Western Blot: MASP2 Antibody [NBP1-81259] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...