anti-Human MASP1 Antikörper für Immunohistochemistry

Recommended MASP1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Mannan-Binding Lectin serine Peptidase 1 (C4/C2 Activating Component of Ra-Reactive Factor) (MASP1) Antikörper
  • AW048060
  • CCPII
  • Crarf
  • Masp1/3
  • 3MC1
  • CRARF
  • CRARF1
  • MAP1
  • MASP
  • MASP3
  • MAp44
  • PRSS5
  • RaRF
  • mannan-binding lectin serine peptidase 1
  • mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor)
  • Masp1
  • MASP1
Reaktivität
Human
74
24
24
2
2
1
1
1
1
Wirt
Kaninchen
52
21
1
Klonalität
Polyklonal
Konjugat
Dieser MASP1 Antikörper ist unkonjugiert
4
4
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
61
19
13
4
4
3
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4299992
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1876894 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN3048411 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal

Ähnliche anti-MASP1 Antikörper

Applikation / Reaktivität Human
ELISA 19 Antikörper
Enzyme Immunoassay (EIA) 3 Antikörper
Immunoassay (IA) 2 Antikörper
Immunofluorescence (IF) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 3 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antikörper
Immunoprecipitation (IP) 4 Antikörper
Western Blotting (WB) 61 Antikörper

General

Antigen Mannan-Binding Lectin serine Peptidase 1 (C4/C2 Activating Component of Ra-Reactive Factor) (MASP1) Antikörper
Reaktivität Human
(74), (24), (24), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(52), (21), (1)
Klonalität
Polyklonal
Konjugat Dieser MASP1 Antikörper ist unkonjugiert
(4), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(61), (19), (13), (4), (4), (3), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-MASP1 Antikörper

Target Details MASP1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT
Isotyp IgG

Target Details MASP1

Produktdetails anti-MASP1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Complement Factor MASP3/MASP1 (MASP1 Antibody Abstract)
Hintergrund Gene Symbol: MASP1
Gen-ID 5648
Pathways Komplementsystem

Anwendungsinformationen

Produktdetails anti-MASP1 Antikörper Target Details MASP1 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-MASP1 Antikörper Target Details MASP1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-MASP1 Antikörper Target Details MASP1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-MASP1 Antikörper (Mannan-Binding Lectin serine Peptidase 1 (C4/C2 Activating Component of Ra-Reactive Factor)) (ABIN4299992) Immunohistochemistry: Complement Factor MASP3/MASP1 Antibody [NBP1-85460] - Staining ...