anti-Human Kallikrein 4 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Kallikrein 4 Antibody (geliefert von: Anmelden zum Anzeigen )

Kallikrein-Related Peptidase 4 (KLK4) Antikörper
  • ESMP1
  • KLK-L1
  • PSTS
  • Prss17
  • AI2A1
  • ARM1
  • EMSP
  • EMSP1
  • PRSS17
  • kallikrein
  • Emsp1
  • kallikrein related-peptidase 4 (prostase, enamel matrix, prostate)
  • kallikrein-related peptidase 4
  • Klk4
  • KLK4
Dieser Kallikrein 4 Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4328112
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN152277 IHC (fro) IHC (p) IP IHC ELISA WB Rabbit AA 242-254 Anmelden zum Anzeigen Polyclonal
1 ABIN1736154 IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 262-277 Anmelden zum Anzeigen Polyclonal
1 ABIN1736155 IHC (fro) IHC (p) IP ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal


Antigen Kallikrein-Related Peptidase 4 (KLK4) Antikörper
Reaktivität Human
(67), (11), (7)
Wirt Kaninchen
(55), (19)
Konjugat Dieser Kallikrein 4 Antikörper ist unkonjugiert
(3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(62), (27), (19), (7), (6), (5), (4), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Kallikrein 4 Antikörper

Target Details Kallikrein 4 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: TIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSK LYDPLYH
Isotyp IgG

Target Details Kallikrein 4

Produktdetails anti-Kallikrein 4 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung Kallikrein 4/Prostase/EMSP1 (KLK4 Antibody Abstract)
Hintergrund Gene Symbol: KLK4
Gen-ID 9622
Pathways Komplementsystem


Produktdetails anti-Kallikrein 4 Antikörper Target Details Kallikrein 4 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-Kallikrein 4 Antikörper Target Details Kallikrein 4 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-Kallikrein 4 Antikörper Target Details Kallikrein 4 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Kallikrein-Related Peptidase 4 (KLK4) antibody (ABIN4328112) Immunohistochemistry-Paraffin: Kallikrein 4/Prostase/EMSP1 Antibody [NBP2-14171] - St...