anti-Human Coagulation Factor XII (Hageman Factor) Antikörper für Immunohistochemistry

Recommended Coagulation Factor XII (Hageman Factor) Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Coagulation Factor XII (Hageman Factor) (F12) Antikörper
  • HAE3
  • HAEX
  • HAF
  • FXII
  • coagulation factor XII (Hageman factor)
  • F12
Reaktivität
Human
153
34
29
2
1
Wirt
Kaninchen
89
30
24
18
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
12
9
8
4
4
4
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
107
88
20
20
11
9
9
5
5
4
4
2
2
2
2
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4310030
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.637035 ABIN2957569 IHC WB Rabbit Heavy Chain, N-Term Anmelden zum Anzeigen Polyclonal
9.637035 ABIN4310032 ICC IF IHC IHC (p) WB Rabbit AA 50-150, Internal Region Anmelden zum Anzeigen Polyclonal
9.637035 ABIN2471332 IHC ELISA WB Sheep IgG full length Anmelden zum Anzeigen Polyclonal
9.637035 ABIN2404520 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1872625 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1858750 ICC IHC IP WB Rabbit IgG AA 400-615 Anmelden zum Anzeigen Polyclonal
1 ABIN3022402 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2885670 IHC ELISA WB Rabbit IgG AA 1-50, Cleaved-Ile20 Anmelden zum Anzeigen Polyclonal
1 ABIN2879866 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2235834 IC IHC ELISA WB Rabbit IgG AA 400-615 Anmelden zum Anzeigen Polyclonal
1 ABIN2894407 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN4310031 ICC IF IHC IHC (p) WB Rabbit AA 50-150, Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2695359 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2676056 IHC Mouse IgG1 AA 73-372 Anmelden zum Anzeigen OTI1H5
1 ABIN2990151 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2263500 IHC ELISA WB Sheep IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2766549 IP IHC (p) IHC ELISA Goat IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2896370 ELISA IF/ICC IHC WB Rabbit AA 400-615 Anmelden zum Anzeigen Polyclonal

anti-Coagulation Factor XII (Hageman Factor) Antikörper für Immunohistochemistry mit den meisten Publikationen

Ähnliche anti-Coagulation Factor XII (Hageman Factor) Antikörper

Applikation / Reaktivität Human
ELISA 81 Antikörper
ELISA (Capture) 1 Antikörper
ELISA (Detection) 5 Antikörper
Enzyme Immunoassay (EIA) 9 Antikörper
Functional Studies (Func) 2 Antikörper
Immunochromatography (IC) 1 Antikörper
Immunocytochemistry (ICC) 3 Antikörper
Immunodiffusion (ID) 5 Antikörper
Immunoelectrophoresis (IEP) 4 Antikörper
Immunofluorescence (IF) 2 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antikörper
Immunohistochemistry (IHC) 19 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 21 Antikörper
Immunoprecipitation (IP) 8 Antikörper
Neutralization (Neut) 1 Antikörper
Proximity Ligation Assay (PLA) 2 Antikörper

General

Antigen Coagulation Factor XII (Hageman Factor) (F12) Antikörper
Reaktivität Human
(153), (34), (29), (2), (1)
Wirt Kaninchen
(89), (30), (24), (18), (1)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(12), (9), (8), (4), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(107), (88), (20), (20), (11), (9), (9), (5), (5), (4), (4), (2), (2), (2), (2), (2), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDA
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung Factor XII (F12 Antibody Abstract)
Hintergrund Gene Symbol: F12
Gen-ID 2161
Forschungsgebiet Cardiovascular, Coagulation
Pathways Komplementsystem

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Coagulation Factor XII (Hageman Factor) (F12) Antikörper (ABIN4310030) Immunohistochemistry: Factor XII Antibody [NBP1-86518] - Immunohistochemical staining...