anti-Human C8G Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended C8G Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Complement Component 8, gamma Polypeptide (C8G) Antikörper
  • C8C
  • complement component 8, gamma polypeptide
  • C8G
  • C8g
Reaktivität
Human
7
1
1
1
1
1
1
1
1
Wirt
Kaninchen
7
Klonalität
Polyklonal
Konjugat
Dieser C8G Antikörper ist unkonjugiert
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
5
3
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4286610
Preis und Verfügbarkeit auf Anfrage.

General

Antigen Complement Component 8, gamma Polypeptide (C8G) Antikörper
Reaktivität Human
(7), (1), (1), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(7)
Klonalität
Polyklonal
Konjugat Dieser C8G Antikörper ist unkonjugiert
(1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(5), (3), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-C8G Antikörper

Target Details C8G Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: STIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTA MAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAET
Isotyp IgG

Target Details C8G

Produktdetails anti-C8G Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung C8G (C8G Antibody Abstract)
Hintergrund Gene Symbol: C8G
Gen-ID 733
Pathways Komplementsystem

Anwendungsinformationen

Produktdetails anti-C8G Antikörper Target Details C8G Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-C8G Antikörper Target Details C8G Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-C8G Antikörper Target Details C8G Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Complement Component 8, gamma Polypeptide (C8G) antibody (ABIN4286610) Western Blot: C8G Antibody [NBP2-14422] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Complement Component 8, gamma Polypeptide (C8G) antibody (ABIN4286610) Immunohistochemistry-Paraffin: C8G Antibody [NBP2-14422] - Staining of human kidney s...