anti-Human IL6ST Antikörper für Immunohistochemistry

Recommended IL6ST Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Interleukin 6 Signal Transducer (Gp130, Oncostatin M Receptor) (IL6ST) Antikörper
  • CD130
  • CDW130
  • GP130
  • IL-6RB
  • 5133400A03Rik
  • AA389424
  • BB405851
  • D13Ertd699e
  • gp130
  • Ac1055
  • Gp130
  • Il-6rb
  • NCR
  • interleukin 6 signal transducer (gp130, oncostatin M receptor)
  • interleukin 6 signal transducer
  • neutrophil migration
  • IL6ST
  • Il6st
  • il6st
  • LOC100349330
  • NM
Reaktivität
Human
204
114
56
4
4
3
2
2
1
1
1
1
Wirt
Kaninchen
119
111
59
3
3
2
Klonalität
Polyklonal
Konjugat
Dieser IL6ST Antikörper ist unkonjugiert
17
15
14
11
11
9
9
8
8
8
8
7
6
5
4
3
3
3
3
3
2
2
2
2
2
2
2
2
2
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
148
121
62
30
26
18
17
14
12
11
8
6
4
4
3
2
2
2
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4315411
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.637848 ABIN483170 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1383683 FACS IP IHC WB Mouse IgG1 Anmelden zum Anzeigen B-P4 26
1 ABIN2789417 IHC WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal
1 ABIN3183732 ELISA IF IHC WB Rabbit IgG Ser552 Anmelden zum Anzeigen Polyclonal
1 ABIN4315414 ICC IF IHC IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN4903171 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1722538 Func FACS IP IHC Mouse IgG1 Anmelden zum Anzeigen B-P8
1 ABIN1722539 Func FACS IP IHC ELISA WB Mouse IgG1 Anmelden zum Anzeigen B-P4
1 ABIN1961639 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 878-906 Anmelden zum Anzeigen Polyclonal
1 ABIN1966638 IHC ELISA WB Biotin Rabbit IgG AA 878-906 Anmelden zum Anzeigen Polyclonal
1 ABIN1964019 IHC ELISA WB APC Rabbit IgG AA 878-906 Anmelden zum Anzeigen Polyclonal
1 ABIN1975037 IHC ELISA WB PE Rabbit IgG AA 878-906 Anmelden zum Anzeigen Polyclonal
1 ABIN1970459 IHC ELISA WB FITC Rabbit IgG AA 878-906 Anmelden zum Anzeigen Polyclonal
1 ABIN2609975 ELISA IHC WB Rabbit IgG AA 878-906 Anmelden zum Anzeigen Polyclonal
1 ABIN1972527 IHC ELISA WB HRP Rabbit IgG AA 878-906 Anmelden zum Anzeigen Polyclonal
1 ABIN1722451 FACS IHC Mouse IgG2a Anmelden zum Anzeigen B-R3
1 ABIN2222618 IHC ELISA WB Rabbit IgG C-Term, AA 878-906 Anmelden zum Anzeigen Polyclonal
1 ABIN2222622 IHC ELISA WB PE Rabbit IgG C-Term, AA 878-906 Anmelden zum Anzeigen Polyclonal
1 ABIN2222621 IHC ELISA WB HRP Rabbit IgG C-Term, AA 878-906 Anmelden zum Anzeigen Polyclonal
1 ABIN2222620 IHC ELISA WB FITC Rabbit IgG C-Term, AA 878-906 Anmelden zum Anzeigen Polyclonal

anti-IL6ST Antikörper für Immunohistochemistry mit den meisten Publikationen

Ähnliche anti-IL6ST Antikörper

Applikation / Reaktivität Human
Biochemical Assay (BCA) 1 Antikörper
Blocking Peptide (BP) 2 Antikörper
Cytometry by Time of Flight (CyTOF) 1 Antikörper
Dot Blot (DB) 17 Antikörper
ELISA 50 Antikörper
ELISA (Capture) 2 Antikörper
ELISA (Detection) 2 Antikörper
Enzyme Immunoassay (EIA) 6 Antikörper
Flow Cytometry (FACS) 84 Antikörper
Functional Studies (Func) 10 Antikörper
Immunocytochemistry (ICC) 2 Antikörper
Immunofluorescence (IF) 10 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 2 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 26 Antikörper
Immunohistochemistry (IHC) 29 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 17 Antikörper
Immunoprecipitation (IP) 11 Antikörper
Neutralization (Neut) 4 Antikörper

General

Antigen Interleukin 6 Signal Transducer (Gp130, Oncostatin M Receptor) (IL6ST) Antikörper
Reaktivität Human
(204), (114), (56), (4), (4), (3), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(119), (111), (59), (3), (3), (2)
Klonalität
Polyklonal
Konjugat Dieser IL6ST Antikörper ist unkonjugiert
(17), (15), (14), (11), (11), (9), (9), (8), (8), (8), (8), (7), (6), (5), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(148), (121), (62), (30), (26), (18), (17), (14), (12), (11), (8), (6), (4), (4), (3), (2), (2), (2), (2), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-IL6ST Antikörper

Target Details IL6ST Anwendungsinformationen Handhabung ProductDetails: References for anti-IL6ST antibody (ABIN4315411) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI
Isotyp IgG

Target Details IL6ST

Produktdetails anti-IL6ST Antikörper Anwendungsinformationen Handhabung ProductDetails: References for anti-IL6ST antibody (ABIN4315411) Bilder zurück nach oben
Antigen
Andere Bezeichnung Gp130/CD130 (IL6ST Antibody Abstract)
Hintergrund Gene Symbol: IL6ST
Gen-ID 3572
Pathways JAK-STAT Signalweg, Cellular Glucan Metabolic Process, Autophagie, Smooth Muscle Cell Migration

Anwendungsinformationen

Produktdetails anti-IL6ST Antikörper Target Details IL6ST Handhabung ProductDetails: References for anti-IL6ST antibody (ABIN4315411) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-IL6ST Antikörper Target Details IL6ST Anwendungsinformationen ProductDetails: References for anti-IL6ST antibody (ABIN4315411) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-IL6ST antibody (ABIN4315411)

Produktdetails anti-IL6ST Antikörper Target Details IL6ST Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Rognum, Haynes, Vege, Yang, Rognum, Kinney: "Interleukin-6 and the serotonergic system of the medulla oblongata in the sudden infant death syndrome." in: Acta neuropathologica, Vol. 118, Issue 4, pp. 519-30, 2009

Bilder

Produktdetails anti-IL6ST Antikörper Target Details IL6ST Anwendungsinformationen Handhabung ProductDetails: References for anti-IL6ST antibody (ABIN4315411) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-IL6ST Antikörper (Interleukin 6 Signal Transducer (Gp130, Oncostatin M Receptor)) (ABIN4315411) Immunohistochemistry: gp130/CD130 Antibody [NBP1-88138] - Immunohistochemical stainin...