anti-Ratte (Rattus) Selenoprotein S Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Selenoprotein S Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Selenoprotein S (SELS) Antikörper
  • ADO15
  • SBBI8
  • SELS
  • SEPS1
  • 1500011E07Rik
  • C78786
  • H-4
  • H-47
  • H4
  • H47
  • Sels
  • sg2
  • VCP-interacting membrane protein
  • VIMP
  • Vimp
Reaktivität
Human, Maus, Ratte (Rattus)
45
25
24
2
1
1
1
1
1
1
1
1
Wirt
Kaninchen
36
8
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
29
13
11
7
5
4
4
3
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4352486
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN768946 IHC (p) WB Rabbit IgG AA 72-121 Anmelden zum Anzeigen Polyclonal
1 ABIN727184 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN727177 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN727175 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Selenoprotein S (SELS) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(45), (25), (24), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(36), (8)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(29), (13), (11), (7), (5), (4), (4), (3)
Pubmed 3 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung SELS (SELS Antibody Abstract)
Hintergrund Gene Symbol: VIMP
Gen-ID 55829
Forschungsgebiet Signaling, Innate Immunity
Pathways Cellular Response to Molecule of Bacterial Origin, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Cell RedoxHomeostasis, Negative Regulation of intrinsic apoptotic Signaling

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Touat-Hamici, Legrain, Bulteau, Chavatte: "Selective up-regulation of human selenoproteins in response to oxidative stress." in: The Journal of biological chemistry, Vol. 289, Issue 21, pp. 14750-61, 2014 (Probematerial (Species): Human). Weitere Details: Western Blotting

Bubenik, Miniard, Driscoll: "Alternative transcripts and 3'UTR elements govern the incorporation of selenocysteine into selenoprotein S." in: PLoS ONE, Vol. 8, Issue 4, pp. e62102, 2013 Weitere Details: Immunocytochemistry,Western Blotting,Immunofluorescence

Paavilainen, Edvinsson, Asplund, Hober, Kampf, Pontén, Wester: "The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells." in: The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, Vol. 58, Issue 3, pp. 237-46, 2010

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Selenoprotein S (SELS) antibody (ABIN4352486) Western Blot: SELS Antibody [NBP1-89558] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Selenoprotein S (SELS) antibody (ABIN4352486) Immunohistochemistry-Paraffin: SELS Antibody [NBP1-89558] - Staining of human small i...
Western Blotting (WB) image for anti-Selenoprotein S (SELS) antibody (ABIN4352486) Western Blot: SELS Antibody [NBP1-89558] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-Selenoprotein S (SELS) antibody (ABIN4352486) Immunocytochemistry/Immunofluorescence: SELS Antibody [NBP1-89558] - Staining of huma...