anti-Maus Metadherin Antikörper für Immunofluorescence

Recommended Metadherin Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Metadherin (MTDH) Antikörper
  • MGC75963
  • 2610103J23Rik
  • 3D3
  • 3D3/Lyric
  • AEG-1
  • AV353288
  • D8Bwg1112e
  • Lyric
  • AEG1
  • LYRIC
  • LYRIC/3D3
  • metadherin
  • mtdh
  • MTDH
  • Mtdh
Reaktivität
Human, Maus, Ratte (Rattus)
101
33
29
3
1
1
1
1
1
Wirt
Kaninchen
58
42
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
88
45
35
34
27
13
10
6
4
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4332036
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.14905 ABIN2854801 ICC IF IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal
1 ABIN1088540 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1088539 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2407438 IF IP IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Metadherin (MTDH) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(101), (33), (29), (3), (1), (1), (1), (1), (1)
Wirt Kaninchen
(58), (42), (3)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(88), (45), (35), (34), (27), (13), (10), (6), (4), (2), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQD
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung LYRIC (MTDH Antibody Abstract)
Hintergrund Gene Symbol: MTDH
Gen-ID 92140
Forschungsgebiet Microfilaments, Cytoskeleton, Cancer
Pathways Cellular Response to Molecule of Bacterial Origin, Cell-Cell Junction Organization

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Liu, Wu, Peng: "Astrocyte elevated gene-1 regulates osteosarcoma cell invasion and chemoresistance via endothelin-1/endothelin A receptor signaling." in: Oncology letters, Vol. 5, Issue 2, pp. 505-510, 2013

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Western Blot: LYRIC Antibody [NBP1-90328] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Western Blotting (WB) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Western Blot: LYRIC Antibody [NBP1-90328] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90328] - Staining of human cerebr...
Immunofluorescence (IF) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Immunocytochemistry/Immunofluorescence: LYRIC Antibody [NBP1-90328] - Staining of hum...