anti-Human Bystin-Like Antikörper für Immunofluorescence

Recommended Bystin-Like Antibody (geliefert von: Anmelden zum Anzeigen )

Bystin-Like (BYSL) Antikörper
  • CG1430
  • Dmel\\CG1430
  • MGC63889
  • zgc:63889
  • MGC81422
  • MGC97811
  • Bys
  • Enp1
  • by S6
  • bystin-like
  • bystin
  • Bystin
  • bys
  • bysl
  • BYSL
  • LmjF30.0480
  • MCYG_02768
  • BYS1
  • LOC100159994
  • byst
  • LOC100270780
  • Bysl
Human, Maus
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4285613
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.166431 ABIN4285612 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
12.166431 ABIN513838 IF WB Mouse AA 1-437, full length Anmelden zum Anzeigen Polyclonal
12.166431 ABIN513836 IF WB Mouse AA 1-324, full length Anmelden zum Anzeigen Polyclonal
12.166431 ABIN513839 IF WB Mouse AA 1-437, full length Anmelden zum Anzeigen Polyclonal
12.166431 ABIN513837 IF WB Mouse AA 1-324, full length Anmelden zum Anzeigen Polyclonal
1 ABIN2590833 IF WB Mouse IgG AA 1-324 Anmelden zum Anzeigen Polyclonal
1 ABIN2213129 IF WB Mouse IgG AA 1-324 Anmelden zum Anzeigen Polyclonal


Antigen Bystin-Like (BYSL) Antikörper
Reaktivität Human, Maus
(10), (1)
Wirt Kaninchen
(6), (4)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(10), (7), (2), (1), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung BYSL (BYSL Antibody Abstract)
Hintergrund Gene Symbol: BYSL
Gen-ID 705
Forschungsgebiet DNA/RNA, Chromatin and Nuclear Signaling
Pathways Cellular Response to Molecule of Bacterial Origin


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Bystin-Like (BYSL) antibody (ABIN4285613) Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human colon s...
Western Blotting (WB) image for anti-Bystin-Like (BYSL) antibody (ABIN4285613) Western Blot: BYSL Antibody [NBP1-89501] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-Bystin-Like (BYSL) antibody (ABIN4285613) Immunocytochemistry/Immunofluorescence: BYSL Antibody [NBP1-89501] - Staining of huma...
Western Blotting (WB) image for anti-Bystin-Like (BYSL) antibody (ABIN4285613) Western Blot: BYSL Antibody [NBP1-89501] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...