anti-Maus Phosphoglucomutase 1 Antikörper für Immunocytochemistry

Recommended Phosphoglucomutase 1 Antibody (geliefert von: Anmelden zum Anzeigen )

Phosphoglucomutase 1 (PGM1) Antikörper
  • CDG1T
  • GSD14
  • MIO24.4
  • MIO24_4
  • PGM1
  • STF1
  • phosphoglucomutase
  • PSPTO3035
  • CMS0426
  • 3230402E02Rik
  • Pgm-1
  • Pgm2
  • zgc:63718
  • phosphoglucomutase-1
  • pgm2
  • PGM
  • PGM 1
  • phosphoglucomutase 1
  • hypothetical protein
  • phosphoglucomutase
  • phosphoglucomutase alpha-D-glucose phosphate-specific Pgm
  • phosphoglucomutase, alpha-D-glucose phosphate-specific
  • phosphoglucomutase 1 L homeolog
  • PGM1
  • R05F9.6
  • PGM
  • pgm
  • STY0736
  • PMI_RS02700
  • Pgm1
  • pgm1
  • pgm1.L
Human, Maus
Dieser Phosphoglucomutase 1 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4345120
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5078786 ELISA ICC IF WB Mouse IgG1 kappa AA 1-562 Anmelden zum Anzeigen 84G2
1 ABIN5078787 ELISA ICC IF WB Mouse IgG1 kappa AA 1-562 Anmelden zum Anzeigen 84G2


Antigen Phosphoglucomutase 1 (PGM1) Antikörper
Reaktivität Human, Maus
(48), (16), (11), (7), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(32), (16), (3)
Konjugat Dieser Phosphoglucomutase 1 Antikörper ist unkonjugiert
(3), (2), (2), (2), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(43), (21), (21), (16), (15), (7), (5), (5), (4), (4), (3), (3), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Phosphoglucomutase 1 Antikörper

Target Details Phosphoglucomutase 1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPT
Isotyp IgG

Target Details Phosphoglucomutase 1

Produktdetails anti-Phosphoglucomutase 1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung PGM1 (PGM1 Antibody Abstract)
Hintergrund Gene Symbol: PGM1
Gen-ID 5236
Pathways Cellular Glucan Metabolic Process


Produktdetails anti-Phosphoglucomutase 1 Antikörper Target Details Phosphoglucomutase 1 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-Phosphoglucomutase 1 Antikörper Target Details Phosphoglucomutase 1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-Phosphoglucomutase 1 Antikörper Target Details Phosphoglucomutase 1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Phosphoglucomutase 1 (PGM1) antibody (ABIN4345120) Western Blot: PGM1 Antibody [NBP1-85982] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Western Blotting (WB) image for anti-Phosphoglucomutase 1 (PGM1) antibody (ABIN4345120) Western Blot: PGM1 Antibody [NBP1-85982] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunofluorescence (IF) image for anti-Phosphoglucomutase 1 (PGM1) antibody (ABIN4345120) Immunocytochemistry/Immunofluorescence: PGM1 Antibody [NBP1-85982] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phosphoglucomutase 1 (PGM1) antibody (ABIN4345120) Immunohistochemistry-Paraffin: PGM1 Antibody [NBP1-85982] - Staining of human liver s...