anti-Human Phosphoglucomutase 1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Phosphoglucomutase 1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Phosphoglucomutase 1 (PGM1) Antikörper
  • CDG1T
  • GSD14
  • ARABIDOPSIS THALIANA PHOSPHOGLUCOMUTASE
  • ATPGMP
  • MIO24.4
  • MIO24_4
  • PGM1
  • PHOSPHOGLUCOMUTASE
  • STARCH-FREE 1
  • STF1
  • phosphoglucomutase
  • PSPTO3035
  • CMS0426
  • 3230402E02Rik
  • Pgm-1
  • Pgm2
  • zgc:63718
  • phosphoglucomutase-1
  • pgm2
  • PGM
  • PGM 1
  • phosphoglucomutase 1
  • hypothetical protein
  • phosphoglucomutase
  • phosphoglucomutase alpha-D-glucose phosphate-specific Pgm
  • phosphoglucomutase, alpha-D-glucose phosphate-specific
  • phosphoglucomutase 1 L homeolog
  • PGM1
  • R05F9.6
  • PGM
  • pgm
  • STY0736
  • PMI_RS02700
  • Pgm1
  • pgm1
  • pgm1.L
Reaktivität
Human
48
17
11
7
4
3
2
2
2
1
1
1
1
1
Wirt
Maus
33
15
3
Klonalität
Monoklonal
Konjugat
Dieser Phosphoglucomutase 1 Antikörper ist unkonjugiert
3
2
2
2
1
1
1
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
43
22
21
17
16
7
5
5
4
4
3
3
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5078785
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.794758 ABIN4345120 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
13.794758 ABIN4345119 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5531933 IHC (p) WB Rabbit Ig Fraction AA 251-282 Anmelden zum Anzeigen Polyclonal
1 ABIN5650139 IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen CL3299

General

Antigen Phosphoglucomutase 1 (PGM1) Antikörper
Reaktivität Human
(48), (17), (11), (7), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Maus
(33), (15), (3)
Klonalität
Monoklonal
Konjugat Dieser Phosphoglucomutase 1 Antikörper ist unkonjugiert
(3), (2), (2), (2), (1), (1), (1)
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(43), (22), (21), (17), (16), (7), (5), (5), (4), (4), (3), (3), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Phosphoglucomutase 1 Antikörper

Target Details Phosphoglucomutase 1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Protein A purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD
Isotyp IgG1

Target Details Phosphoglucomutase 1

Produktdetails anti-Phosphoglucomutase 1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PGM1 (PGM1 Antibody Abstract)
Hintergrund Gene Symbol: PGM1
Gen-ID 5236
Pathways Cellular Glucan Metabolic Process

Anwendungsinformationen

Produktdetails anti-Phosphoglucomutase 1 Antikörper Target Details Phosphoglucomutase 1 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:2500 - 1:5000This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-Phosphoglucomutase 1 Antikörper Target Details Phosphoglucomutase 1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-Phosphoglucomutase 1 Antikörper Target Details Phosphoglucomutase 1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Phosphoglucomutase 1 (PGM1) antibody (ABIN5078785) Western Blot: PGM1 Antibody - Analysis in human cell line RT-4.
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phosphoglucomutase 1 (PGM1) antibody (ABIN5078785) Immunohistochemistry-Paraffin: PGM1 Antibody - Staining of human small intestine sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phosphoglucomutase 1 (PGM1) antibody (ABIN5078785) Immunohistochemistry-Paraffin: PGM1 Antibody - Staining of human fallopian tube show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phosphoglucomutase 1 (PGM1) antibody (ABIN5078785) Immunohistochemistry-Paraffin: PGM1 Antibody - Staining of human liver shows strong ...