anti-Human Phosphoglucomutase 1 Antikörper für Immunocytochemistry

Recommended Phosphoglucomutase 1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Phosphoglucomutase 1 (PGM1) Antikörper
  • CDG1T
  • GSD14
  • ARABIDOPSIS THALIANA PHOSPHOGLUCOMUTASE
  • ATPGMP
  • MIO24.4
  • MIO24_4
  • PGM1
  • PHOSPHOGLUCOMUTASE
  • STARCH-FREE 1
  • STF1
  • phosphoglucomutase
  • PSPTO3035
  • CMS0426
  • 3230402E02Rik
  • Pgm-1
  • Pgm2
  • zgc:63718
  • phosphoglucomutase-1
  • pgm2
  • PGM
  • PGM 1
  • phosphoglucomutase 1
  • hypothetical protein
  • phosphoglucomutase
  • phosphoglucomutase alpha-D-glucose phosphate-specific Pgm
  • phosphoglucomutase, alpha-D-glucose phosphate-specific
  • phosphoglucomutase 1 L homeolog
  • PGM1
  • R05F9.6
  • PGM
  • pgm
  • STY0736
  • PMI_RS02700
  • Pgm1
  • pgm1
  • pgm1.L
Reaktivität
Human
48
17
11
7
4
3
2
2
2
1
1
1
1
1
Wirt
Kaninchen
32
16
3
Klonalität
Polyklonal
Konjugat
Dieser Phosphoglucomutase 1 Antikörper ist unkonjugiert
3
2
2
2
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
43
21
21
17
15
7
5
5
5
4
3
3
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4890928
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1923275 ICC ELISA WB Alkaline Phosphatase (AP) Mouse IgG1 AA 1-563 Anmelden zum Anzeigen
1 ABIN1923276 ICC ELISA WB APC Mouse IgG1 AA 1-563 Anmelden zum Anzeigen
1 ABIN1923278 ICC ELISA WB FITC Mouse IgG1 AA 1-563 Anmelden zum Anzeigen
1 ABIN1923279 ICC ELISA WB PE Mouse IgG1 AA 1-563 Anmelden zum Anzeigen
1 ABIN1923277 ICC ELISA WB Biotin Mouse IgG1 AA 1-563 Anmelden zum Anzeigen
1 ABIN4345120 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN4345119 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1923280 ICC ELISA WB HRP Mouse IgG1 AA 1-563 Anmelden zum Anzeigen
1 ABIN2626756 ICC IF Rabbit IgG AA 116-404 Anmelden zum Anzeigen Polyclonal
1 ABIN5078786 ELISA ICC IF WB Mouse IgG1 kappa AA 1-562 Anmelden zum Anzeigen 84G2
1 ABIN5078787 ELISA ICC IF WB Mouse IgG1 kappa AA 1-562 Anmelden zum Anzeigen 84G2
1 ABIN5566040 FACS ICC IF IHC APC Rabbit AA 1-562 Anmelden zum Anzeigen Polyclonal
1 ABIN5566042 FACS ICC IF IHC FITC Rabbit AA 1-562 Anmelden zum Anzeigen Polyclonal
1 ABIN5566044 FACS ICC IF IHC PE Rabbit AA 1-562 Anmelden zum Anzeigen Polyclonal
1 ABIN5014092 ICC IHC IP WB Rabbit IgG AA 1-235 Anmelden zum Anzeigen Polyclonal

General

Antigen Phosphoglucomutase 1 (PGM1) Antikörper
Reaktivität Human
(48), (17), (11), (7), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(32), (16), (3)
Klonalität
Polyklonal
Konjugat Dieser Phosphoglucomutase 1 Antikörper ist unkonjugiert
(3), (2), (2), (2), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(43), (21), (21), (17), (15), (7), (5), (5), (5), (4), (3), (3), (2), (2), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Phosphoglucomutase 1 Antikörper

Target Details Phosphoglucomutase 1 Anwendungsinformationen Handhabung Referenzen für anti-Phosphoglucomutase 1 Antikörper (ABIN4890928) Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptides corresponding to PGM1(phosphoglucomutase 1) The peptide sequence was selected from the middle region of PGM1 (NP_002624). Peptide sequence ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI.

Target Details Phosphoglucomutase 1

Produktdetails anti-Phosphoglucomutase 1 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-Phosphoglucomutase 1 Antikörper (ABIN4890928) Bilder zurück nach oben
Antigen
Andere Bezeichnung PGM1 (PGM1 Antibody Abstract)
Hintergrund Gene Symbol: PGM1
Gen-ID 5236
UniProt P36871
Pathways Cellular Glucan Metabolic Process

Anwendungsinformationen

Produktdetails anti-Phosphoglucomutase 1 Antikörper Target Details Phosphoglucomutase 1 Handhabung Referenzen für anti-Phosphoglucomutase 1 Antikörper (ABIN4890928) Bilder zurück nach oben
Applikationshinweise Western Blot 0.2-1 μg/mL, Immunocytochemistry/ImmunofluorescenceUse in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 24558105)
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-Phosphoglucomutase 1 Antikörper Target Details Phosphoglucomutase 1 Anwendungsinformationen Referenzen für anti-Phosphoglucomutase 1 Antikörper (ABIN4890928) Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Referenzen für anti-Phosphoglucomutase 1 Antikörper (ABIN4890928)

Produktdetails anti-Phosphoglucomutase 1 Antikörper Target Details Phosphoglucomutase 1 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Zhu, Sun, Zou, Ge: "Inducible metabolic adaptation promotes mesenchymal stem cell therapy for ischemia: a hypoxia-induced and glycogen-based energy prestorage strategy." in: Arteriosclerosis, thrombosis, and vascular biology, Vol. 34, Issue 4, pp. 870-6, 2014 (Probematerial (Species): Mouse (Murine)). Weitere Details: Immunocytochemistry,Western Blotting,Immunofluorescence

Bilder

Produktdetails anti-Phosphoglucomutase 1 Antikörper Target Details Phosphoglucomutase 1 Anwendungsinformationen Handhabung Referenzen für anti-Phosphoglucomutase 1 Antikörper (ABIN4890928) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Phosphoglucomutase 1 (PGM1) antibody (ABIN4890928) Western Blot: PGM1 Antibody [NBP1-56528] - Hela cell lysate, concentration 0.2-1 ug/ml.