anti-Human APP Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended APP Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Amyloid beta (A4) Precursor Protein (APP) Antikörper
  • APP
  • APP-like
  • APPL
  • Abeta
  • BcDNA:GH04413
  • CG7727
  • Dmel\\CG7727
  • EG:65F1.5
  • appl
  • aaa
  • abeta
  • abpp
  • ad1
  • appi
  • ctfgamma
  • cvap
  • pn2
  • AAA
  • ABETA
  • ABPP
  • AD1
  • APPI
  • CTFgamma
  • CVAP
  • PN-II
  • PN2
  • Abpp
  • Adap
  • Ag
  • Cvap
  • E030013M08Rik
  • betaApp
  • app
  • wu:fj34d10
  • wu:fk65e12
  • zgc:85740
  • beta amyloid protein precursor-like
  • amyloid beta (A4) precursor protein
  • amyloid beta (A4) precursor protein a
  • beta amyloid protein precursor
  • Appl
  • APP
  • app
  • App
  • appa
  • LOC100009546
Reaktivität
Human
875
364
351
40
27
21
19
18
15
13
12
10
7
7
4
4
4
3
2
2
1
Wirt
Kaninchen
630
229
45
7
2
Klonalität
Polyklonal
Konjugat
Dieser APP Antikörper ist unkonjugiert
49
39
39
16
14
13
13
13
13
12
12
12
12
12
12
8
8
4
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
624
365
272
157
149
120
83
55
41
34
18
14
10
9
8
3
2
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4281250
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.400779 ABIN498821 IHC (p) Rabbit pThr668, pThr743 Anmelden zum Anzeigen Polyclonal
13.400779 ABIN498911 IHC (p) Rabbit Anmelden zum Anzeigen Polyclonal
13.400779 ABIN498957 IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal
13.400779 ABIN214038 IF IHC (p) WB Rabbit IgG Thr668 Anmelden zum Anzeigen Polyclonal
13.400779 ABIN364364 IHC (p) ELISA WB Mouse IgG2b, kappa AA 18-289 Anmelden zum Anzeigen J4H9
13.400779 ABIN4281249 ELISA ICC IF IHC IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
13.400779 ABIN2712106 IHC (p) WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal
13.400779 ABIN4281251 FACS ICC IF IHC IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen 7G9
13.400779 ABIN4281248 ELISA IHC IHC (fro) IHC (p) WB Mouse IgG2a Anmelden zum Anzeigen 1B11F3
1 ABIN319013 IHC (p) WB Rabbit IgG AA 737-751 Anmelden zum Anzeigen Polyclonal 2
1 ABIN319014 IHC (p) WB Rabbit IgG AA 653-662 Anmelden zum Anzeigen Polyclonal 2
1 ABIN657612 IF IHC (p) WB Rabbit Ig AA 333-362, Center Anmelden zum Anzeigen Polyclonal 2
1 ABIN725120 IF (p) IHC (p) Rabbit IgG AA 380-430 Anmelden zum Anzeigen Polyclonal 2
1 ABIN390282 FACS IHC (p) WB Rabbit Ig AA 29-61, N-Term Anmelden zum Anzeigen Polyclonal 3
1 ABIN873283 IF (p) IHC (p) WB Rabbit IgG AA 1-42, C-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN3043787 IHC (p) WB Rabbit IgG AA 672-713, C-Term Anmelden zum Anzeigen Polyclonal 4
1 ABIN265307 EIA IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN317496 EIA IHC (p) WB Mouse IgG2b AA 18-289 Anmelden zum Anzeigen J4H9
1 ABIN3044384 IHC (p) WB Rabbit IgG AA 18-32, N-Term Anmelden zum Anzeigen Polyclonal 4
1 ABIN732503 IF (p) IHC (p) Rabbit IgG pTyr757 Anmelden zum Anzeigen Polyclonal

anti-APP Antikörper für Immunohistochemistry (Paraffin-embedded Sections) mit den meisten Publikationen

Ähnliche anti-APP Antikörper

Applikation / Reaktivität Human
Dot Blot (DB) 41 Antikörper
ELISA 344 Antikörper
Enzyme Immunoassay (EIA) 13 Antikörper
Flow Cytometry (FACS) 32 Antikörper
Immunochromatography (IC) 8 Antikörper
Immunocytochemistry (ICC) 47 Antikörper
Immunodiffusion (ID) 3 Antikörper
Immunofluorescence (IF) 117 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 6 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 149 Antikörper
Immunohistochemistry (IHC) 260 Antikörper
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 1 Antikörper
Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) 2 Antikörper
Immunohistochemistry (Frozen Sections) (IHC (fro)) 16 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 154 Antikörper
Immunoprecipitation (IP) 80 Antikörper

General

Antigen Amyloid beta (A4) Precursor Protein (APP) Antikörper
Reaktivität Human
(875), (364), (351), (40), (27), (21), (19), (18), (15), (13), (12), (10), (7), (7), (4), (4), (4), (3), (2), (2), (1)
Wirt Kaninchen
(630), (229), (45), (7), (2)
Klonalität
Polyklonal
Konjugat Dieser APP Antikörper ist unkonjugiert
(49), (39), (39), (16), (14), (13), (13), (13), (13), (12), (12), (12), (12), (12), (12), (8), (8), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(624), (365), (272), (157), (149), (120), (83), (55), (41), (34), (18), (14), (10), (9), (8), (3), (2), (2), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-APP Antikörper

Target Details APP Anwendungsinformationen Handhabung ProductDetails: References for anti-APP antibody (ABIN4281250) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN
Isotyp IgG

Target Details APP

Produktdetails anti-APP Antikörper Anwendungsinformationen Handhabung ProductDetails: References for anti-APP antibody (ABIN4281250) Bilder zurück nach oben
Antigen
Andere Bezeichnung APP (APP Antibody Abstract)
Hintergrund Gene Symbol: APP
Gen-ID 351
Forschungsgebiet Signaling
Pathways Caspase Kaskade in der Apoptose, EGFR Signaling Pathway, Transition Metal Ion Homeostasis, Skeletal Muscle Fiber Development, Toll-Like Receptors Cascades, Feeding Behaviour

Anwendungsinformationen

Produktdetails anti-APP Antikörper Target Details APP Handhabung ProductDetails: References for anti-APP antibody (ABIN4281250) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-APP Antikörper Target Details APP Anwendungsinformationen ProductDetails: References for anti-APP antibody (ABIN4281250) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-APP antibody (ABIN4281250)

Produktdetails anti-APP Antikörper Target Details APP Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Wu, Hsu, Chen, Yu, Chang, Tai, Liu, Su, Chang, Yu: "Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas." in: Molecular & cellular proteomics : MCP, Vol. 9, Issue 6, pp. 1100-17, 2010

Bilder

Produktdetails anti-APP Antikörper Target Details APP Anwendungsinformationen Handhabung ProductDetails: References for anti-APP antibody (ABIN4281250) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-APP Antikörper (Amyloid beta (A4) Precursor Protein) (ABIN4281250) Immunohistochemistry-Paraffin: Amyloid Precursor Protein Antibody [NBP1-90246] Staini...
Immunofluorescence (IF) image for anti-APP Antikörper (Amyloid beta (A4) Precursor Protein) (ABIN4281250) Immunocytochemistry/Immunofluorescence: Amyloid Precursor Protein Antibody [NBP1-9024...