anti-Schwein TJP1 Antikörper für Simple Western

Recommended TJP1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Tight Junction Protein 1 (Zona Occludens 1) (TJP1) Antikörper
  • ZO-1
  • ZO1
  • zo1
  • tight junction protein 1
  • tight junction protein 1 (zona occludens 1)
  • zonula occludens 1
  • TJP1
  • Tjp1
  • ZO1
Reaktivität
Human, Schwein
90
33
33
19
11
5
4
4
3
2
1
1
1
1
Wirt
Kaninchen
72
16
3
3
2
Klonalität
Polyklonal
Konjugat
Dieser TJP1 Antikörper ist unkonjugiert
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes)
73
24
23
23
22
14
13
11
9
8
8
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Produktnummer ABIN4359735
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4359734 ICC IF IHC IHC (p) SimWes Rabbit IgG Anmelden zum Anzeigen Polyclonal

anti-TJP1 Antikörper für Simple Western mit den meisten Publikationen

Ähnliche anti-TJP1 Antikörper

Applikation / Reaktivität Schwein Human
Flow Cytometry (FACS) 1 Antikörper 11 Antikörper
Immunocytochemistry (ICC) 2 Antikörper 9 Antikörper
Immunofluorescence (IF) 2 Antikörper 24 Antikörper
Immunofluorescence (Cultured Cells) (IF (cc)) 13 Antikörper 14 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper 13 Antikörper
Immunohistochemistry (IHC) 3 Antikörper 19 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antikörper
Simple Western (SimWes) 2 Antikörper
Western Blotting (WB) 2 Antikörper
ELISA 22 Antikörper
Enzyme Immunoassay (EIA) 1 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 2 Antikörper

General

Antigen Tight Junction Protein 1 (Zona Occludens 1) (TJP1) Antikörper
Reaktivität Human, Schwein
(90), (33), (33), (19), (11), (5), (4), (4), (3), (2), (1), (1), (1), (1)
Wirt Kaninchen
(72), (16), (3), (3), (2)
Klonalität
Polyklonal
Konjugat Dieser TJP1 Antikörper ist unkonjugiert
(3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes)
(73), (24), (23), (23), (22), (14), (13), (11), (9), (8), (8), (3), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TJP1 Antikörper

Target Details TJP1 Anwendungsinformationen Handhabung ProductDetails: References for anti-TJP1 antibody (ABIN4359735) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED
Isotyp IgG

Target Details TJP1

Produktdetails anti-TJP1 Antikörper Anwendungsinformationen Handhabung ProductDetails: References for anti-TJP1 antibody (ABIN4359735) Bilder zurück nach oben
Antigen
Andere Bezeichnung Tight Junction Protein 1 (TJP1 Antibody Abstract)
Hintergrund Gene Symbol: TJP1
Gen-ID 7082
Pathways Carbohydrate Homeostasis, Cell-Cell Junction Organization

Anwendungsinformationen

Produktdetails anti-TJP1 Antikörper Target Details TJP1 Handhabung ProductDetails: References for anti-TJP1 antibody (ABIN4359735) Bilder zurück nach oben
Applikationshinweise Simple Western 1:20, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500Immunohistochemistry retrieval method recommended:HIER pH 6, Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100. In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TJP1 Antikörper Target Details TJP1 Anwendungsinformationen ProductDetails: References for anti-TJP1 antibody (ABIN4359735) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-TJP1 antibody (ABIN4359735)

Produktdetails anti-TJP1 Antikörper Target Details TJP1 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

McIntyre, Alev, Mechael, Salci, Lee, Fiebig-Comyn, Guezguez, Wu, Sheng, Bhatia: "Expansive generation of functional airway epithelium from human embryonic stem cells." in: Stem cells translational medicine, Vol. 3, Issue 1, pp. 7-17, 2014 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry