anti-Ratte (Rattus) SCP2 Antikörper für Immunocytochemistry

Recommended SCP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Sterol Carrier Protein 2 (SCP2) Antikörper
  • NLTP
  • NSL-TP
  • SCP-2
  • SCP-CHI
  • SCP-X
  • SCPX
  • AI586070
  • D10Ertd73e
  • OS-4
  • OS4
  • SCP2
  • AA409774
  • AA409893
  • C76618
  • C79031
  • ns-LTP
  • NSLIPTR
  • SCPx
  • MGC77634
  • zgc:77634
  • MGC108409
  • ATSCP2
  • MBD2.8
  • MBD2_8
  • STEROL CARRIER PROTEIN 2
  • PLTP
  • sterol carrier protein 2
  • CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2
  • sterol carrier protein 2, liver
  • SCP2 (STEROL CARRIER PROTEIN 2); oxidoreductase/ sterol carrier
  • phospholipid transfer protein homolog1
  • SCP2
  • Ctdsp2
  • Scp2
  • scp2
  • CC1G_13192
  • plt1
Reaktivität
Human, Maus, Ratte (Rattus)
137
34
29
5
4
3
3
3
2
2
1
1
1
1
Wirt
Kaninchen
103
19
16
Klonalität
Polyklonal
Konjugat
Dieser SCP2 Antikörper ist unkonjugiert
9
9
9
5
5
5
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
98
65
54
26
13
5
5
5
3
3
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4352277
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5014353 ICC IHC IP WB Rabbit IgG AA 433-547 Anmelden zum Anzeigen Polyclonal

General

Antigen Sterol Carrier Protein 2 (SCP2) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(137), (34), (29), (5), (4), (3), (3), (3), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(103), (19), (16)
Klonalität
Polyklonal
Konjugat Dieser SCP2 Antikörper ist unkonjugiert
(9), (9), (9), (5), (5), (5), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(98), (65), (54), (26), (13), (5), (5), (5), (3), (3)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SCP2 Antikörper

Target Details SCP2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKH
Isotyp IgG

Target Details SCP2

Produktdetails anti-SCP2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung SCP2 (SCP2 Antibody Abstract)
Hintergrund Gene Symbol: SYCP2
Gen-ID 10388
Pathways C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process

Anwendungsinformationen

Produktdetails anti-SCP2 Antikörper Target Details SCP2 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SCP2 Antikörper Target Details SCP2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SCP2 Antikörper Target Details SCP2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Sterol Carrier Protein 2 (SCP2) antibody (ABIN4352277) Immunohistochemistry-Paraffin: SCP2 Antibody [NBP1-85958] - Staining of human liver s...
Western Blotting (WB) image for anti-Sterol Carrier Protein 2 (SCP2) antibody (ABIN4352277) Western Blot: SCP2 Antibody [NBP1-85958] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-Sterol Carrier Protein 2 (SCP2) antibody (ABIN4352277) Immunocytochemistry/Immunofluorescence: SCP2 Antibody [NBP1-85958] - Staining of huma...
Western Blotting (WB) image for anti-Sterol Carrier Protein 2 (SCP2) antibody (ABIN4352277) Western Blot: SCP2 Antibody [NBP1-85958] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...