anti-Human Dehydrogenase/reductase (SDR Family) Member 9 Antikörper für Immunohistochemistry

Recommended Dehydrogenase/reductase (SDR Family) Member 9 Antibody (geliefert von: Anmelden zum Anzeigen )

Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9) Antikörper
  • rdhl
  • 3alpha-hsd
  • rdh15
  • retsdr8
  • DHRS9
  • Akr1c9
  • RDH15
  • RDHL
  • SDR9C4
  • C730025I08Rik
  • Rdh15
  • Rdhl
  • dehydrogenase/reductase (SDR family) member 9
  • retinol dehydrogenase 5 (11-cis/9-cis)
  • aldo-keto reductase family 1, member C14
  • dhrs9
  • RDH5
  • DHRS9
  • Akr1c14
  • Dhrs9
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4305170
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4305169 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1980340 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2598437 ELISA IHC IHC (p) HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2598438 ELISA IHC IHC (p) Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2598439 ELISA IHC IHC (p) FITC Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2881613 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN798118 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN1992044 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN375333 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2968988 IF/ICC IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal


Antigen Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9) Antikörper
Reaktivität Human
(45), (10), (10), (2), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(38), (8)
Konjugat Unkonjugiert
(3), (3), (3)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(37), (19), (10), (6), (6), (5), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGN
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung DHRS9 (DHRS9 Antibody Abstract)
Hintergrund Gene Symbol: DHRS9
Gen-ID 10170
Forschungsgebiet Metabolism
Pathways C21-Steroid Hormone Metabolic Process


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9) antibody (ABIN4305170) Immunocytochemistry/Immunofluorescence: DHRS9 Antibody [NBP1-89379] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9) antibody (ABIN4305170) Immunohistochemistry-Paraffin: DHRS9 Antibody [NBP1-89379] - Staining of human kidney...
Western Blotting (WB) image for anti-Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9) antibody (ABIN4305170) Western Blot: DHRS9 Antibody [NBP1-89379] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...