anti-Human TREX1 Antikörper für Western Blotting

Recommended TREX1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
three Prime Repair Exonuclease 1 (TREX1) Antikörper
  • AGS1
  • CRV
  • DRN3
  • HERNS
  • 1661
  • AU041952
  • RGD1309596
  • three prime repair exonuclease 1
  • CpipJ_CPIJ012074
  • Tsp_03749
  • TREX1
  • Trex1
Epitop
AA 156-185, Middle Region
5
4
4
3
3
3
3
3
2
2
2
2
1
1
Reaktivität
Human
56
12
9
Wirt
Kaninchen
30
29
Klonalität
Polyklonal
Konjugat
Dieser TREX1 Antikörper ist unkonjugiert
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
53
37
25
16
13
5
5
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN3043537
340,48 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.3140206 ABIN524703 WB Rabbit AA 1-369, full length Anmelden zum Anzeigen Polyclonal 2
3.3140206 ABIN2967111 IC IF WB Rabbit Anmelden zum Anzeigen Polyclonal
3.3140206 ABIN4249334 ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 11
3.3140206 ABIN2560538 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.3140206 ABIN524701 WB Mouse AA 1-369, full length Anmelden zum Anzeigen Polyclonal
3.3140206 ABIN524705 ELISA WB Mouse IgG2b kappa AA 1-100, partial Anmelden zum Anzeigen 2F10
3.3140206 ABIN1031144 IHC ELISA WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal
3.3140206 ABIN524700 WB Mouse AA 1-304, full length Anmelden zum Anzeigen Polyclonal
3.3140206 ABIN524702 WB Mouse AA 1-369, full length Anmelden zum Anzeigen Polyclonal
3.3140206 ABIN524704 WB Rabbit AA 1-304, full length Anmelden zum Anzeigen Polyclonal
1 ABIN341718 ELISA IHC WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN5555375 EIA IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal
1 ABIN524706 ELISA WB Mouse IgG2a kappa AA 1-100, partial Anmelden zum Anzeigen 1B1
1 ABIN4362286 ELISA ICC IF IHC IHC (p) WB Rabbit Center Anmelden zum Anzeigen Polyclonal
1 ABIN4362289 WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal
1 ABIN4362291 IHC IHC (p) WB Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4362290 IHC IHC (p) WB Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN5516849 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal
1 ABIN2882441 IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN4362292 IHC IHC (fro) IHC (p) WB Rabbit AA 200-350, Internal Region Anmelden zum Anzeigen Polyclonal

anti-TREX1 Antikörper für Western Blotting mit den meisten Publikationen

Ähnliche anti-TREX1 Antikörper

Applikation / Reaktivität Human
ELISA 16 Antikörper
Enzyme Immunoassay (EIA) 1 Antikörper
Immunochromatography (IC) 1 Antikörper
Immunocytochemistry (ICC) 5 Antikörper
Immunofluorescence (IF) 11 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 1 Antikörper
Immunohistochemistry (IHC) 37 Antikörper
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 25 Antikörper
Immunoprecipitation (IP) 5 Antikörper
Western Blotting (WB) 51 Antikörper

General

Antigen three Prime Repair Exonuclease 1 (TREX1) Antikörper
Epitop AA 156-185, Middle Region
(5), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1)
Reaktivität Human
(56), (12), (9)
Wirt Kaninchen
(30), (29)
Klonalität
Polyklonal
Konjugat Dieser TREX1 Antikörper ist unkonjugiert
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(53), (37), (25), (16), (13), (5), (5), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TREX1 Antikörper

Target Details TREX1 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.
Sequenz DDNLANLLLA FLRRQPQPWC LVAHNGDRYD
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.
Gene Name: three prime repair exonuclease 1
Protein Name: Three-prime repair exonuclease 1
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human TREX1 (156-185aa DDNLANLLLAFLRRQPQPWCLVAHNGDRYD), different from the related mouse sequence by four amino acids.
Isotyp IgG

Target Details TREX1

Produktdetails anti-TREX1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung TREX1 (TREX1 Antibody Abstract)
Hintergrund Three prime repair exonuclease 1 is an enzyme that in humans is encoded by the TREX1 gene. This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.

Synonyms: 3' 5' exonuclease TREX1 antibody|3' repair exonuclease 1 antibody|AGS1 antibody|AGS5 antibody|CRV antibody|Deoxyribonuclease III, dnaQ/mutD (E. coli) like antibody|DKFZp434J0310 antibody|DNase III antibody|DRN3 antibody|HERNS antibody|Three prime repair exonuclease 1 antibody|TREX1 antibody
Gen-ID 11277
Forschungsgebiet Immunology, DNA/RNA
Pathways Apoptose

Anwendungsinformationen

Produktdetails anti-TREX1 Antikörper Target Details TREX1 Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TREX1 Antikörper Target Details TREX1 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails anti-TREX1 Antikörper Target Details TREX1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-TREX1 Antikörper (three Prime Repair Exonuclease 1) (AA 156-185) (ABIN3043537) anti-three Prime Repair Exonuclease 1 (TREX1) (AA 156-185), (Middle Region) antibody