anti-Human TREX1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended TREX1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
three Prime Repair Exonuclease 1 (TREX1) Antikörper
  • AGS1
  • CRV
  • DRN3
  • HERNS
  • 1661
  • AU041952
  • RGD1309596
  • three prime repair exonuclease 1
  • CpipJ_CPIJ012074
  • Tsp_03749
  • TREX1
  • Trex1
Reaktivität
Human
56
12
9
Wirt
Kaninchen
30
29
Klonalität
Polyklonal
Konjugat
Dieser TREX1 Antikörper ist unkonjugiert
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
54
36
24
16
12
5
4
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4362288
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5555375 EIA IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal
1 ABIN4362286 ELISA ICC IF IHC IHC (p) WB Rabbit Center Anmelden zum Anzeigen Polyclonal
1 ABIN4362291 IHC IHC (p) WB Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4362290 IHC IHC (p) WB Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4362292 IHC IHC (fro) IHC (p) WB Rabbit AA 200-350, Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN4362293 IHC IHC (fro) IHC (p) WB Rabbit AA 200-350, Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN4249324 IHC IHC (p) WB PerCP Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249323 IHC IHC (p) WB DyLight 755 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249328 IHC IHC (p) WB DyLight 405 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249332 IHC IHC (p) WB Alexa Fluor 647 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249321 IHC IHC (p) WB DyLight 488 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249327 IHC IHC (p) WB DyLight 350 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249331 IHC IHC (p) WB Alexa Fluor 488 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249330 IHC IHC (p) WB Alexa Fluor 405 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249319 IHC IHC (p) WB DyLight 650 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249318 IHC IHC (p) WB Biotin Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249326 IHC IHC (p) WB DyLight 550 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249320 IHC IHC (p) WB DyLight 680 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4249333 IHC IHC (p) WB Alexa Fluor 700 Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2
1 ABIN4994398 IHC IHC (p) FITC Mouse IgG2b kappa Anmelden zum Anzeigen 41M5F2

anti-TREX1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections) mit den meisten Publikationen

Ähnliche anti-TREX1 Antikörper

Applikation / Reaktivität Human
ELISA 16 Antikörper
Enzyme Immunoassay (EIA) 1 Antikörper
Immunochromatography (IC) 1 Antikörper
Immunocytochemistry (ICC) 5 Antikörper
Immunofluorescence (IF) 11 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 1 Antikörper
Immunohistochemistry (IHC) 37 Antikörper
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 25 Antikörper
Immunoprecipitation (IP) 5 Antikörper
Western Blotting (WB) 51 Antikörper

General

Antigen three Prime Repair Exonuclease 1 (TREX1) Antikörper
Reaktivität Human
(56), (12), (9)
Wirt Kaninchen
(30), (29)
Klonalität
Polyklonal
Konjugat Dieser TREX1 Antikörper ist unkonjugiert
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(54), (36), (24), (16), (12), (5), (4), (2), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TREX1 Antikörper

Target Details TREX1 Anwendungsinformationen Handhabung ProductDetails: References for anti-TREX1 antibody (ABIN4362288) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD
Isotyp IgG

Target Details TREX1

Produktdetails anti-TREX1 Antikörper Anwendungsinformationen Handhabung ProductDetails: References for anti-TREX1 antibody (ABIN4362288) Bilder zurück nach oben
Antigen
Andere Bezeichnung TREX1 (TREX1 Antibody Abstract)
Hintergrund Gene Symbol: TREX1
Gen-ID 11277
Forschungsgebiet DNA/RNA, Immunology
Pathways Apoptose

Anwendungsinformationen

Produktdetails anti-TREX1 Antikörper Target Details TREX1 Handhabung ProductDetails: References for anti-TREX1 antibody (ABIN4362288) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TREX1 Antikörper Target Details TREX1 Anwendungsinformationen ProductDetails: References for anti-TREX1 antibody (ABIN4362288) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-TREX1 antibody (ABIN4362288)

Produktdetails anti-TREX1 Antikörper Target Details TREX1 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Sakai, Miyazaki, Shin, Kim, Qi, Fariss, Munasinghe, Wang, Kovalchuk, Kothari, Fermaintt, Atkinson, Perrino, Yan, Morse: "DNase-active TREX1 frame-shift mutants induce serologic autoimmunity in mice." in: Journal of autoimmunity, Vol. 81, pp. 13-23, 2017 Von den Autoren verwendete Methode: Western Blotting (WB) (Probematerial (Species): Mouse (Murine)).

Bilder

Produktdetails anti-TREX1 Antikörper Target Details TREX1 Anwendungsinformationen Handhabung ProductDetails: References for anti-TREX1 antibody (ABIN4362288) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-TREX1 Antikörper (three Prime Repair Exonuclease 1) (ABIN4362288) Immunohistochemistry-Paraffin: TREX1 Antibody - Staining of human colon shows modera...