anti-Ratte (Rattus) BIRC2 Antikörper für Immunofluorescence

Recommended BIRC2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Baculoviral IAP Repeat Containing 2 (BIRC2) Antikörper
  • Api1
  • Api2
  • IAP1
  • IAP2
  • MIHB
  • MIHC
  • Birc2
  • HIAP2
  • MIAP1
  • MIAP2
  • RNF49
  • cIAP1
  • cIAP2
  • cIAP-1
  • cIAP-2
  • AW107670
  • ciap-1
  • API1
  • Hiap-2
  • RNF48
  • c-IAP1
  • ITA
  • AW146227
  • Birc3
  • HIAP1
  • mcIAP1
  • rIAP1
  • RGD1559914
  • baculoviral IAP repeat-containing 3
  • inhibitor of apoptosis protein-1
  • baculoviral IAP repeat containing 2
  • baculoviral IAP repeat-containing 2
  • NLR family, apoptosis inhibitory protein 5
  • Birc3
  • ciap-1
  • BIRC2
  • Birc2
  • Naip5
Reaktivität
Human, Ratte (Rattus)
116
48
32
4
2
2
1
Wirt
Kaninchen
103
17
Klonalität
Polyklonal
Konjugat
Dieser BIRC2 Antikörper ist unkonjugiert
5
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
117
52
33
28
15
10
6
5
4
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4298713
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
11.915192 ABIN1871293 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
11.915192 ABIN2403734 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2888050 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Baculoviral IAP Repeat Containing 2 (BIRC2) Antikörper
Reaktivität Human, Ratte (Rattus)
(116), (48), (32), (4), (2), (2), (1)
Wirt Kaninchen
(103), (17)
Klonalität
Polyklonal
Konjugat Dieser BIRC2 Antikörper ist unkonjugiert
(5), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(117), (52), (33), (28), (15), (10), (6), (5), (4), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-BIRC2 Antikörper

Target Details BIRC2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF
Isotyp IgG

Target Details BIRC2

Produktdetails anti-BIRC2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung cIAP-1/HIAP-2 (BIRC2 Antibody Abstract)
Hintergrund Gene Symbol: BIRC2
Gen-ID 329
Pathways Apoptose, Caspase Kaskade in der Apoptose, Activation of Innate immune Response, Toll-Like Receptors Cascades

Anwendungsinformationen

Produktdetails anti-BIRC2 Antikörper Target Details BIRC2 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200Immunohistochemistry retrieval recommended: HIER pH 6, Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-BIRC2 Antikörper Target Details BIRC2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-BIRC2 Antikörper Target Details BIRC2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Baculoviral IAP Repeat Containing 2 (BIRC2) antibody (ABIN4298713) Western Blot: cIAP-1/HIAP-2 Antibody [NBP1-90133] - Lane 1: Marker [kDa] 220, 112, 84...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Baculoviral IAP Repeat Containing 2 (BIRC2) antibody (ABIN4298713) Immunohistochemistry-Paraffin: cIAP-1/HIAP-2 Antibody [NBP1-90133] - Staining of huma...
Immunofluorescence (IF) image for anti-Baculoviral IAP Repeat Containing 2 (BIRC2) antibody (ABIN4298713) Immunocytochemistry/Immunofluorescence: cIAP-1/HIAP-2 Antibody [NBP1-90133] - Stainin...
Western Blotting (WB) image for anti-Baculoviral IAP Repeat Containing 2 (BIRC2) antibody (ABIN4298713) Western Blot: cIAP-1/HIAP-2 Antibody [NBP1-90133] - Lane 1: NIH-3T3 cell lysate (Mous...