Parathyroid Hormone 2 (PTH2) (Middle Region) Antikörper

Produktnummer ABIN636078

Produktdetails

Target: Parathyroid Hormone 2 (PTH2)

Bindungsspezifität: Middle Region

Reaktivität: Hormone

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTH2 antibody was raised against the middle region of PTH2

Aufreinigung: Affinity purified

Immunogen: PTH2 antibody was raised using the middle region of PTH2 corresponding to a region with amino acids WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTH2 Blocking Peptide, catalog no. 33R-9931, is also available for use as a blocking control in assays to test for specificity of this PTH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Parathyroid Hormone 2 (PTH2)

Andere Bezeichnung: PTH2 (PTH2 Produkte)

Synonyme: TIP39 antikoerper, Tifp39 antikoerper, Tip39 antikoerper, RGD1559447 antikoerper, pth2 antikoerper, parathyroid hormone 2 antikoerper, parathyroid hormone 1b antikoerper, tuberoinfundibular 39 residue protein antikoerper, PTH2 antikoerper, Pth2 antikoerper, pth1b antikoerper, TIP39 antikoerper

Substanzklasse: Hormone

Hintergrund: TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.

Molekulargewicht: 11 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development