HS6ST3 Antikörper (C-Term)

Produktnummer ABIN636033

Produktdetails anti-HS6ST3 Antikörper

Target: HS6ST3 (Heparan Sulfate 6-O-Sulfotransferase 3 (HS6ST3))

Bindungsspezifität: C-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HS6ST3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HS6 ST3 antibody was raised against the C terminal of HS6 T3

Aufreinigung: Affinity purified

Immunogen: HS6 ST3 antibody was raised using the C terminal of HS6 T3 corresponding to a region with amino acids TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HS6ST3 Blocking Peptide, catalog no. 33R-9146, is also available for use as a blocking control in assays to test for specificity of this HS6ST3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HS6ST3

Target: HS6ST3 (Heparan Sulfate 6-O-Sulfotransferase 3 (HS6ST3))

Andere Bezeichnung: HS6ST3 (HS6ST3 Produkte)

Synonyme: HS6ST-3 antikoerper, 6OST3 antikoerper, RGD1560050 antikoerper, hs6st3 antikoerper, heparan sulfate 6-O-sulfotransferase 3 antikoerper, heparan sulfate 6-O-sulfotransferase 3b antikoerper, HS6ST3 antikoerper, Hs6st3 antikoerper, hs6st3b antikoerper

Hintergrund: Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammation, blood coagulation, and other diverse processes.

Molekulargewicht: 55 kDa (MW of target protein)