FKBP11 Antikörper (N-Term)

Produktnummer ABIN635804

Produktdetails anti-FKBP11 Antikörper

Target: FKBP11 (FK506 Binding Protein 11, 19 KDa (FKBP11))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FKBP11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FKBP11 antibody was raised against the N terminal of FKBP11

Aufreinigung: Affinity purified

Immunogen: FKBP11 antibody was raised using the N terminal of FKBP11 corresponding to a region with amino acids VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FKBP11 Blocking Peptide, catalog no. 33R-9792, is also available for use as a blocking control in assays to test for specificity of this FKBP11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FKBP11

Target: FKBP11 (FK506 Binding Protein 11, 19 KDa (FKBP11))

Andere Bezeichnung: FKBP11 (FKBP11 Produkte)

Synonyme: MGC85245 antikoerper, 1110002O23Rik antikoerper, FKBP-11 antikoerper, si:dz202l16.2 antikoerper, wu:fd54d02 antikoerper, zgc:110640 antikoerper, FKBP19 antikoerper, FK506 binding protein 11 L homeolog antikoerper, FK506 binding protein 11 antikoerper, fkbp11.L antikoerper, FKBP11 antikoerper, Fkbp11 antikoerper, fkbp11 antikoerper

Hintergrund: FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin.

Molekulargewicht: 19 kDa (MW of target protein)