PIGF Antikörper (N-Term)

Produktnummer ABIN635684

Produktdetails anti-PIGF Antikörper

Target: PIGF (Phosphatidylinositol Glycan F (PIGF))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIGF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIGF antibody was raised against the N terminal of PIGF

Aufreinigung: Affinity purified

Immunogen: PIGF antibody was raised using the N terminal of PIGF corresponding to a region with amino acids MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIGF Blocking Peptide, catalog no. 33R-6128, is also available for use as a blocking control in assays to test for specificity of this PIGF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIGF

Target: PIGF (Phosphatidylinositol Glycan F (PIGF))

Andere Bezeichnung: PIGF (PIGF Produkte)

Synonyme: pigf antikoerper, zgc:77184 antikoerper, phosphatidylinositol glycan anchor biosynthesis class F antikoerper, phosphatidylinositol glycan anchor biosynthesis, class F antikoerper, phosphatidylinositol glycan anchor biosynthesis class F S homeolog antikoerper, PIGF antikoerper, Pigf antikoerper, pigf.S antikoerper, pigf antikoerper

Hintergrund: PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Inositol Metabolic Process