CYP4V2 Antikörper (Middle Region)

Produktnummer ABIN635585

Produktdetails anti-CYP4V2 Antikörper

Target: CYP4V2 (Cytochrome P450, Family 4, Subfamily V, Polypeptide 2 (CYP4V2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP4V2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP4 V2 antibody was raised against the middle region of CYP4 2

Aufreinigung: Affinity purified

Immunogen: CYP4 V2 antibody was raised using the middle region of CYP4 2 corresponding to a region with amino acids RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP4V2 Blocking Peptide, catalog no. 33R-8274, is also available for use as a blocking control in assays to test for specificity of this CYP4V2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP4V2

Target: CYP4V2 (Cytochrome P450, Family 4, Subfamily V, Polypeptide 2 (CYP4V2))

Andere Bezeichnung: CYP4V2 (CYP4V2 Produkte)

Synonyme: BCD antikoerper, CYP4AH1 antikoerper, CYP4V antikoerper, bcd antikoerper, cyp4ah1 antikoerper, MGC147146 antikoerper, cytochrome P450 family 4 subfamily V member 2 antikoerper, cytochrome P450 family 4 subfamily V member 2 S homeolog antikoerper, cytochrome P450, family 4, subfamily V, polypeptide 2 antikoerper, cytochrome P450, family 4, subfamily v, polypeptide 2 antikoerper, CYP4V2 antikoerper, cyp4v2.S antikoerper, cyp4v2 antikoerper

Hintergrund: This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy.

Molekulargewicht: 61 kDa (MW of target protein)