BVES Antikörper (Middle Region)

Produktnummer ABIN635131

Produktdetails anti-BVES Antikörper

Target: BVES (Blood Vessel Epicardial Substance (BVES))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BVES Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BVES antibody was raised against the middle region of BVES

Aufreinigung: Affinity purified

Immunogen: BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BVES Blocking Peptide, catalog no. 33R-10170, is also available for use as a blocking control in assays to test for specificity of this BVES antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BVES antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BVES

Target: BVES (Blood Vessel Epicardial Substance (BVES))

Andere Bezeichnung: BVES (BVES Produkte)

Synonyme: HBVES antikoerper, POP1 antikoerper, POPDC1 antikoerper, Pop1 antikoerper, Popdc1 antikoerper, mBVES antikoerper, Popeye-1 antikoerper, Xbves antikoerper, Xbves-A antikoerper, Xpop-1 antikoerper, Xpop-1-A antikoerper, pop-1 antikoerper, pop1 antikoerper, pop1-A antikoerper, popdc1 antikoerper, popdc1-A antikoerper, zgc:86887 antikoerper, BVES antikoerper, Xpop-1-B antikoerper, bves antikoerper, pop1-B antikoerper, popdc1-B antikoerper, hbves antikoerper, blood vessel epicardial substance antikoerper, blood vessel epicardial substance L homeolog antikoerper, blood vessel epicardial substance S homeolog antikoerper, BVES antikoerper, Bves antikoerper, bves.L antikoerper, bves antikoerper, bves.S antikoerper

Hintergrund: This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in development of these tissues. The mouse ortholog may be involved in the regeneration of adult skeletal muscle and may act as a cell adhesion molecule in coronary vasculogenesis. Two transcript variants encoding the same protein have been found for this gene.

Molekulargewicht: 41 kDa (MW of target protein)