SLC15A4 Antikörper (Middle Region)
-
- Target Alle SLC15A4 Antikörper anzeigen
- SLC15A4 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC15A4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC15 A4 antibody was raised against the middle region of SLC15 4
- Aufreinigung
- Affinity purified
- Immunogen
- SLC15 A4 antibody was raised using the middle region of SLC15 4 corresponding to a region with amino acids GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
- Top Product
- Discover our top product SLC15A4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC15A4 Blocking Peptide, catalog no. 33R-3409, is also available for use as a blocking control in assays to test for specificity of this SLC15A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC15A4 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4))
- Andere Bezeichnung
- SLC15A4 (SLC15A4 Produkte)
- Synonyme
- bZ1L10.1 antikoerper, zgc:56484 antikoerper, zgc:63767 antikoerper, pht1 antikoerper, ptr4 antikoerper, MGC80026 antikoerper, PHT1 antikoerper, PTR4 antikoerper, AA987064 antikoerper, AW742963 antikoerper, C130069N12Rik antikoerper, solute carrier family 15 (oligopeptide transporter), member 4 antikoerper, solute carrier family 15 member 4 antikoerper, solute carrier family 15 member 4 L homeolog antikoerper, solute carrier family 15, member 4 antikoerper, slc15a4 antikoerper, SLC15A4 antikoerper, slc15a4.L antikoerper, Slc15a4 antikoerper
- Hintergrund
- SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.
- Molekulargewicht
- 62 kDa (MW of target protein)
-