DIRC2 Antikörper (Middle Region)
-
- Target Alle DIRC2 Antikörper anzeigen
- DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DIRC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DIRC2 antibody was raised against the middle region of DIRC2
- Aufreinigung
- Affinity purified
- Immunogen
- DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ
- Top Product
- Discover our top product DIRC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DIRC2 Blocking Peptide, catalog no. 33R-1018, is also available for use as a blocking control in assays to test for specificity of this DIRC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))
- Andere Bezeichnung
- DIRC2 (DIRC2 Produkte)
- Synonyme
- MGC80843 antikoerper, zgc:92095 antikoerper, rcc4 antikoerper, MGC69320 antikoerper, RCC4 antikoerper, disrupted in renal carcinoma 2 antikoerper, disrupted in renal carcinoma 2 L homeolog antikoerper, disrupted in renal carcinoma 2 (human) antikoerper, DIRC2 antikoerper, dirc2.L antikoerper, dirc2 antikoerper, Dirc2 antikoerper
- Hintergrund
- DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined.
- Molekulargewicht
- 52 kDa (MW of target protein)
-