SLC39A8 Antikörper

Produktnummer ABIN635083

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC39A8 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SLC39A8 Antikörper (ABIN635083)

Target: SLC39A8 (Solute Carrier Family 39 (Zinc Transporter), Member 8 (SLC39A8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC39A8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC39A8 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC39 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC39A8 Blocking Peptide, (ABIN5616251), is also available for use as a blocking control in assays to test for specificity of this SLC39A8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC39A8

Target: SLC39A8 (Solute Carrier Family 39 (Zinc Transporter), Member 8 (SLC39A8))

Andere Bezeichnung: SLC39A8

Hintergrund: This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import

Molekulargewicht: 50 kDa (MW of target protein)