PEMT Antikörper (C-Term)
-
- Target Alle PEMT Antikörper anzeigen
- PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PEMT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PEMT antibody was raised against the C terminal of PEMT
- Aufreinigung
- Affinity purified
- Immunogen
- PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS
- Top Product
- Discover our top product PEMT Primärantikörper
-
anti-Phosphatidylethanolamine N-Methyltransferase (PEMT) (AA 170-199), (C-Term) antibody
PEMT Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB12628 unconjugated
anti-Phosphatidylethanolamine N-Methyltransferase (PEMT) (AA 1-30), (N-Term) antibodyPEMT Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB13024 unconjugated
anti-Phosphatidylethanolamine N-Methyltransferase (PEMT) (AA 2-49) antibodyPEMT Reaktivität: Human WB, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphatidylethanolamine N-Methyltransferase (PEMT) antibodyPEMT Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphatidylethanolamine N-Methyltransferase (PEMT) (C-Term) antibodyPEMT Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Schwein, Kaninchen, Rind (Kuh), Saccharomyces cerevisiae, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphatidylethanolamine N-Methyltransferase (PEMT) (AA 1-236) antibodyPEMT Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphatidylethanolamine N-Methyltransferase (PEMT) (AA 1-236) antibodyPEMT Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Phosphatidylethanolamine N-Methyltransferase (PEMT) (C-Term) antibodyPEMT Reaktivität: Human, Maus, Hund, Meerschweinchen, Pferd, Schwein, Kaninchen, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PEMT Blocking Peptide, catalog no. 33R-3664, is also available for use as a blocking control in assays to test for specificity of this PEMT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEMT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))
- Andere Bezeichnung
- PEMT (PEMT Produkte)
- Synonyme
- zgc:55479 antikoerper, DDBDRAFT_0204815 antikoerper, DDBDRAFT_0267053 antikoerper, DDB_0204815 antikoerper, DDB_0267053 antikoerper, DDBDRAFT_0219474 antikoerper, DDBDRAFT_0267052 antikoerper, DDB_0219474 antikoerper, DDB_0267052 antikoerper, PEAMT antikoerper, PEMPT antikoerper, PEMT2 antikoerper, PNMT antikoerper, AI255394 antikoerper, Pempt antikoerper, Pempt2 antikoerper, PHOMETH antikoerper, phosphatidylethanolamine N-methyltransferase antikoerper, pemt antikoerper, MCA3065 antikoerper, pmtA antikoerper, CNG04250 antikoerper, pemtA antikoerper, pemtB antikoerper, PEMT antikoerper, Pemt antikoerper
- Hintergrund
- PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17.
- Molekulargewicht
- 26 kDa (MW of target protein)
-
