MFRP Antikörper (Middle Region)
-
- Target Alle MFRP Antikörper anzeigen
- MFRP (Membrane Frizzled-Related Protein (MFRP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MFRP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MFRP antibody was raised against the middle region of MFRP
- Aufreinigung
- Affinity purified
- Immunogen
- MFRP antibody was raised using the middle region of MFRP corresponding to a region with amino acids HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS
- Top Product
- Discover our top product MFRP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MFRP Blocking Peptide, catalog no. 33R-3691, is also available for use as a blocking control in assays to test for specificity of this MFRP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFRP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MFRP (Membrane Frizzled-Related Protein (MFRP))
- Andere Bezeichnung
- MFRP (MFRP Produkte)
- Synonyme
- MFRP antikoerper, MCOP5 antikoerper, NNO2 antikoerper, RD6 antikoerper, rd6 antikoerper, C1q and TNF related 5 antikoerper, membrane frizzled-related protein antikoerper, C1QTNF5 antikoerper, MFRP antikoerper, Mfrp antikoerper
- Hintergrund
- MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic mRNA, which also encodes C1q and tumor necrosis factor related protein 5.
- Molekulargewicht
- 62 kDa (MW of target protein)
-