GPRC5A Antikörper (C-Term)
-
- Target Alle GPRC5A Antikörper anzeigen
- GPRC5A (G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPRC5A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GPCR5 A antibody was raised against the C terminal Of Gpcr5
- Aufreinigung
- Affinity purified
- Immunogen
- GPCR5 A antibody was raised using the C terminal Of Gpcr5 corresponding to a region with amino acids SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY
- Top Product
- Discover our top product GPRC5A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPCR5A Blocking Peptide, catalog no. 33R-8711, is also available for use as a blocking control in assays to test for specificity of this GPCR5A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPCR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPRC5A (G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A))
- Andere Bezeichnung
- GPCR5A (GPRC5A Produkte)
- Synonyme
- GPCR5A antikoerper, RAI3 antikoerper, RAIG1 antikoerper, Rai3 antikoerper, Raig1 antikoerper, G protein-coupled receptor class C group 5 member A antikoerper, G protein-coupled receptor, family C, group 5, member A antikoerper, G protein-coupled receptor, class C, group 5, member A antikoerper, GPRC5A antikoerper, Gprc5a antikoerper
- Hintergrund
- GPCR5A is a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. Its gene may play a role in embryonic development and epithelial cell differentiation.
- Molekulargewicht
- 39 kDa (MW of target protein)
-