GGT7 Antikörper (C-Term)

Produktnummer ABIN634986

Produktdetails anti-GGT7 Antikörper

Target: GGT7 (gamma-Glutamyltransferase 7 (GGT7))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GGT7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GGTL3 antibody was raised against the C terminal Of Ggtl3

Aufreinigung: Affinity purified

Immunogen: GGTL3 antibody was raised using the C terminal Of Ggtl3 corresponding to a region with amino acids ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GGTL3 Blocking Peptide, catalog no. 33R-4055, is also available for use as a blocking control in assays to test for specificity of this GGTL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGTL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GGT7

Target: GGT7 (gamma-Glutamyltransferase 7 (GGT7))

Andere Bezeichnung: GGTL3 (GGT7 Produkte)

Synonyme: D20S101 antikoerper, GGT4 antikoerper, GGTL3 antikoerper, GGTL5 antikoerper, dJ18C9.2 antikoerper, 1110017C11Rik antikoerper, 6330563L03Rik antikoerper, Ggtl3 antikoerper, gamma-glutamyltransferase 7 antikoerper, GGT7 antikoerper, Ggt7 antikoerper

Hintergrund: GGTL3 is an enzyme involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. GGTL3 consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis.

Molekulargewicht: 70 kDa (MW of target protein)