TMEM163 Antikörper (Middle Region)

Produktnummer ABIN634949

Produktdetails anti-TMEM163 Antikörper

Target: TMEM163 (Transmembrane Protein 163 (TMEM163))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM163 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM163 antibody was raised against the middle region of TMEM163

Aufreinigung: Affinity purified

Immunogen: TMEM163 antibody was raised using the middle region of TMEM163 corresponding to a region with amino acids AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM163 Blocking Peptide, catalog no. 33R-1058, is also available for use as a blocking control in assays to test for specificity of this TMEM163 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM163 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM163

Target: TMEM163 (Transmembrane Protein 163 (TMEM163))

Andere Bezeichnung: TMEM163 (TMEM163 Produkte)

Synonyme: si:dkey-57b6.2 antikoerper, DC29 antikoerper, SV31 antikoerper, 2610024A01Rik antikoerper, RGD1306212 antikoerper, Sv31 antikoerper, transmembrane protein 163a antikoerper, Transmembrane protein 163 antikoerper, transmembrane protein 163 antikoerper, transmembrane protein 163 L homeolog antikoerper, tmem163a antikoerper, tm163 antikoerper, TMEM163 antikoerper, Tmem163 antikoerper, tmem163.L antikoerper

Hintergrund: The function of TMEM163 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 31 kDa (MW of target protein)