CNNM4 Antikörper (Middle Region)

Produktnummer ABIN634896

Produktdetails anti-CNNM4 Antikörper

Target: CNNM4 (Cyclin M4 (CNNM4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNNM4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Cyclin M4 antibody was raised against the middle region of CNNM4

Aufreinigung: Affinity purified

Immunogen: Cyclin M4 antibody was raised using the middle region of CNNM4 corresponding to a region with amino acids LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cyclin M4 Blocking Peptide, catalog no. 33R-5118, is also available for use as a blocking control in assays to test for specificity of this Cyclin M4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNNM4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNNM4

Target: CNNM4 (Cyclin M4 (CNNM4))

Andere Bezeichnung: Cyclin M4 (CNNM4 Produkte)

Synonyme: DKFZp468E0110 antikoerper, ACDP4 antikoerper, 5430430O18Rik antikoerper, Acdp4 antikoerper, cyclin and CBS domain divalent metal cation transport mediator 4 antikoerper, cyclin M4 antikoerper, CNNM4 antikoerper, CpipJ_CPIJ006743 antikoerper, cnnm4 antikoerper, Cnnm4 antikoerper

Hintergrund: CNNM4 belongs to the ACDP family.It is a metal transporter. The interaction with the metal ion chaperone COX11 suggests that CNNM4 may play a role in sensory neuron functions.

Molekulargewicht: 86 kDa (MW of target protein)