Myoferlin Antikörper
-
- Target Alle Myoferlin (MYOF) Antikörper anzeigen
- Myoferlin (MYOF)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Myoferlin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FER1 L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
- Top Product
- Discover our top product MYOF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FER1L3 Blocking Peptide, catalog no. 33R-7747, is also available for use as a blocking control in assays to test for specificity of this FER1L3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FER0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Myoferlin (MYOF)
- Andere Bezeichnung
- FER1L3 (MYOF Produkte)
- Synonyme
- FER1L3 antikoerper, 2310004N10Rik antikoerper, 2310051D19Rik antikoerper, E030042N20Rik antikoerper, Fer1l3 antikoerper, RGD1564216 antikoerper, zgc:63504 antikoerper, fer1l3 antikoerper, myoferlin antikoerper, MYOF antikoerper, Myof antikoerper, myof antikoerper, LOC100380767 antikoerper
- Hintergrund
- Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair.
- Molekulargewicht
- 235 kDa (MW of target protein)
-