GGCX Antikörper (Middle Region)
-
- Target Alle GGCX Antikörper anzeigen
- GGCX (gamma-Glutamyl Carboxylase (GGCX))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GGCX Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GGCX antibody was raised against the middle region of GGCX
- Aufreinigung
- Affinity purified
- Immunogen
- GGCX antibody was raised using the middle region of GGCX corresponding to a region with amino acids FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE
- Top Product
- Discover our top product GGCX Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GGCX Blocking Peptide, catalog no. 33R-2973, is also available for use as a blocking control in assays to test for specificity of this GGCX antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGCX antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GGCX (gamma-Glutamyl Carboxylase (GGCX))
- Andere Bezeichnung
- GGCX (GGCX Produkte)
- Hintergrund
- GGCX is an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency.
- Molekulargewicht
- 87 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-