GGCX Antikörper (Middle Region)

Produktnummer ABIN634862

Produktdetails anti-GGCX Antikörper

Target: GGCX (gamma-Glutamyl Carboxylase (GGCX))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GGCX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GGCX antibody was raised against the middle region of GGCX

Aufreinigung: Affinity purified

Immunogen: GGCX antibody was raised using the middle region of GGCX corresponding to a region with amino acids FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GGCX Blocking Peptide, catalog no. 33R-2973, is also available for use as a blocking control in assays to test for specificity of this GGCX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGCX antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GGCX

Target: GGCX (gamma-Glutamyl Carboxylase (GGCX))

Andere Bezeichnung: GGCX (GGCX Produkte)

Hintergrund: GGCX is an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency.

Molekulargewicht: 87 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom